KEGG   Enterobacter cloacae ECR091: ECR091_13520Help
Entry
ECR091_13520      CDS       T03378                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
eclc  Enterobacter cloacae ECR091
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECR091_13520
Enzymes [BR:eclc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ECR091_13520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2859660..2861147
Genome map
AA seq 495 aa AA seqDB search
MRNPTLLQCFHWYYPTGGELWREVTALAPNLNEIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSVATKYGDKAQLLEAINALKSNQIAVLLDVVVNHKMGADEKEPVRVQRV
DAQDRTQISDEIIECEAWTRYTFPVRAGQYSQFIWDYKCFSGIDHIENPSEDGIFKIVND
YTGEGWNDQVDDEMGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTHCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPQPLFIVAEYWSHEVDKLQQYINQVDGKTMLFDAPLQMKFHEAS
RQGRDYDMSQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYPDLFGASYDDTGGDGETYHIDMPVIEQLHELILARQRFAHGVQTLFFDHPNCI
AFSRSGTEEQPGCVVVLSNGDNGEKTICLGENYGNKTWRDFLGNREETVTTAADGEGTFF
CNGGSVSVWVIEDAL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacccaacacttttacaatgttttcactggtactaccccaccggcggtgaattg
tggcgagaagtcacggcattagcccccaacctgaacgaaatcggcatcaatatggtctgg
ttacccccggcctacaaaggcgcatccggcggctattccgtcgggtatgactcttatgac
cttttcgacctcggtgagtttgaccagaaaggcagcgtcgccaccaaatacggcgataaa
gcccaactgctggaggccatcaacgccttaaaaagcaaccagattgcggtgcttctggac
gtggtggtcaaccataaaatgggggccgatgaaaaggaacccgtccgcgtgcaacgcgtg
gatgctcaggatcgcacccaaatcagcgatgagatcatcgaatgtgaagcctggacgcgc
tacaccttccccgttcgggccgggcagtattcgcagttcatctgggattacaaatgcttt
agcggtatcgaccacattgaaaatcccagtgaggacggtatcttcaaaatcgttaacgac
tacaccggcgaaggctggaacgatcaggtcgacgacgagatgggcaatttcgattacctg
atgggtgaaaatattgattttcgcaaccacgcggtgacggaggagatcaaatactgggcg
cgctgggtgatggagcaaacccactgcgacggcttccgcctggacgcggtaaaacacatt
ccggcctggttctataaagagtggattgaacatgtccaggaggtggccccgcagccgcta
tttattgtggcggaatactggtctcacgaagtggataaattgcagcaatacatcaatcag
gtggacggcaaaaccatgttgtttgacgcgccgctgcaaatgaaatttcacgaagcgtca
cgccagggacgcgactacgatatgagccagattttcaccggtacgctggtggaagccgat
ccgttccatgccgtaacgctggtggccaaccatgacacccagcccttgcaggcgctggaa
gccccggttgaagcctggttcaaaccgctggcctacgcgctcatcctgctgcgtgaaaac
ggcgtgccgagcgtgttctacccggatctttttggcgccagctatgacgacactggcggg
gatggtgagacgtatcacattgatatgccggtgattgaacagctccacgagctgatcctc
gcccggcagcgttttgcccacggcgtgcaaaccctctttttcgatcatccaaactgcatt
gcgtttagccgcagcgggacagaggagcaaccgggctgtgtggtggtgctgtcgaatggt
gataacggtgagaagacgatctgcctcggcgagaattacggcaataagacctggcgggat
tttttaggcaaccgcgaggaaaccgtgaccacggcggctgatggcgaagggacgttcttc
tgtaacgggggaagcgtcagcgtctgggtgattgaggacgcgctgtag

DBGET integrated database retrieval system