KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_04840Help
Entry
ENC_04840         CDS       T02615                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Pathway
eclo00473  D-Alanine metabolism
eclo01100  Metabolic pathways
eclo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eclo00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ENC_04840
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ENC_04840
Enzymes [BR:eclo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ENC_04840
Peptidoglycan biosynthesis and degradation proteins [BR:eclo01011]
 Precursor biosynthesis
  Racemase
   ENC_04840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CBK84509
LinkDB All DBs
Position
512648..513727
Genome map
AA seq 359 aa AA seqDB search
MQAATVVINRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGITQPILLLEGFFEASDLPTIADQHLHTAVHNEEQLAALETAELSEPVTVW
MKLDTGMHRLGVRPESAEAFYQRLSQCKNVRQPVNIVSHFARADEPECGATEQQLDIFNT
FCEGKPGMRSIAASGGILLWPQSHFDWARPGIILYGVSPLENKPWGPDFGFKPVMSLVSK
LIAVREHKAGEPVGYGGTWTSEHDTRLGVVAMGYGDGYPRAAPTGTPVLVNGREVKIVGR
VAMDMICVDLGPDAQDKAGDDAVMWGEGLPVERIAEITKVSAYELITRLTSRVAMKYVD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggcaactgttgtgattaaccgccgcgctctgcgacacaacctgcaacgtctg
cgagaactggcgcccgccagtaagctcgttgcagtcgtgaaagcgaacgcttacggacac
ggtcttcttgagaccgcgcgaacgctccccgatgccgacgcttttggcgtcgcccgtctc
gaagaagctctccgcctgcgcgcaggtggaattacgcaaccgatactgctcctggaaggc
ttttttgaagcctcggacctgccgaccattgccgatcagcacctgcacacggcggtgcat
aacgaagaacagctggccgcgctggaaacggctgaactgagcgagccggtcaccgtctgg
atgaagctcgacacgggcatgcaccgtctgggcgtgcggccggaaagcgcggaggcgttt
tatcagcgtctgagtcagtgcaaaaatgtgcgtcagccagtgaatatcgtcagccacttt
gcccgcgccgatgagcctgaatgcggcgcaacggaacagcagcttgatatcttcaacacc
ttctgcgaaggcaaaccggggatgcgctccattgcggcgtccggcgggatcctgctatgg
ccgcagtcgcacttcgactgggcgcgtccgggcatcattctttatggcgtttcgccgctg
gagaacaaaccctgggggccggactttggctttaagccggttatgtcgctggtttcaaag
ctgattgccgtgcgtgagcacaaagcgggagagccggtgggttacggcggcacctggacc
agcgagcacgacacgcgtcttggcgtggtggcgatgggctacggcgacggctatccccgc
gccgcgccaactgggacgccggtgctggtcaatggacgcgaagtcaagattgtcggtcgc
gtggcgatggacatgatttgtgttgatcttgggcccgacgcgcaggataaagcgggggac
gatgcggtgatgtggggtgaaggcctgccggtagagcgtattgctgaaataacaaaagtg
agtgcttacgaacttatcacgcgccttacctcaagggtcgcaatgaaatacgtcgactaa

DBGET integrated database retrieval system