KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_05480Help
Entry
ENC_05480         CDS       T02615                                 

Definition
(GenBank) Glycosidases
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ENC_05480
Enzymes [BR:eclo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ENC_05480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(580375..581862)
Genome map
AA seq 495 aa AA seqDB search
MRNPTLLQCFHWYYPTGGELWREVTALAPNLNEIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSVATKYGDKAQLLEAINALKSNQIAVLLDVVVNHKMGADEKEPVRVQRV
DAQDRTQISDEIIECEAWTRYTFPVRAGQYSQFIWDYKCFSGIDHIENPNEDGIFKIVND
YTGEGWNDQVDDEMGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTHCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPQPLFIVAEYWSHEVDKLQHYINQVDGKTMLFDAPLQMKFHEAS
RQGRDYDMSQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYPDLFGASYDDTGGDGETYHIDMPVIEQLHELILARQRFAHGVQTLFFDHPNCI
AFSRSGTEEHPGCVVVLSNGDDGEKTICLGENYGNKTWRDFLGNREETVTTAADGEGTFF
CNGGSVSVWVIEDAL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacccaacacttttacaatgttttcactggtactaccccaccggcggtgaactg
tggcgagaagtcacggcattagcccccaacctgaacgaaatcggcatcaatatggtctgg
ttaccgccggcatacaaaggggcatccggcggctattccgtcgggtatgactcttatgac
cttttcgacctcggtgagtttgaccagaaaggcagcgtcgccaccaaatacggcgataaa
gcccagctgctggaggccatcaacgccttaaaaagcaaccagattgcggtgcttctggac
gtggtggtcaaccacaaaatgggggccgatgaaaaggaacccgtccgcgtgcagcgcgtg
gatgctcaggatcgcacccaaatcagcgatgagatcatcgaatgcgaagcctggacgcgt
tacaccttccccgttcgggccgggcagtattcgcaattcatctgggattacaaatgcttc
agcggtatcgaccacattgaaaaccccaatgaggacggtatcttcaaaatcgtgaacgac
tacaccggcgaaggctggaacgatcaggtcgacgacgagatgggcaatttcgattacctg
atgggtgaaaacattgattttcgcaaccatgcggtgacggaggagatcaaatactgggcg
cgctgggtgatggagcaaacccactgcgacggcttccgcctggacgcggtaaaacacatc
ccggcctggttctacaaagagtggattgagcacgtccaggaggtggccccgcagccgctg
tttattgtggcggaatactggtctcacgaagtggataaattgcagcactacatcaatcag
gtggacggtaaaaccatgctgtttgatgcgccgctgcaaatgaaatttcacgaagcctca
cgccagggacgcgactacgatatgagccagattttcaccggtacgctggtggaagccgat
ccgttccatgccgtgaccctggtagccaaccacgatacccaacccttgcaggcgctggaa
gccccggttgaagcctggttcaaaccgctggcctacgcgctcatcctgctgcgtgaaaac
ggcgtgccgagtgtattctacccggatctttttggcgccagctatgacgacaccggcggg
gatggcgagacgtatcacatcgatatgccggtgattgaacagctccacgagctgatcctc
gcccggcagcgttttgcccacggcgtgcagacgctgtttttcgatcatccaaactgcatt
gcgttcagccgcagcgggactgaggagcacccgggctgtgtggtggtgctgtcgaatggt
gatgacggcgagaagaccatctgcctcggggaaaattacggcaataagacctggcgtgat
tttttaggcaaccgcgaggaaaccgtgaccacggcggcggatggcgaagggacgttcttc
tgtaacgggggaagcgtcagcgtctgggtgattgaggacgcgctgtaa

DBGET integrated database retrieval system