KEGG   Enterobacter cloacae complex sp. 35734: LI67_009865Help
Entry
LI67_009865       CDS       T04878                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ecls  Enterobacter cloacae complex sp. 35734
Pathway
ecls00020  Citrate cycle (TCA cycle)
ecls00480  Glutathione metabolism
ecls01100  Metabolic pathways
ecls01110  Biosynthesis of secondary metabolites
ecls01120  Microbial metabolism in diverse environments
ecls01130  Biosynthesis of antibiotics
ecls01200  Carbon metabolism
ecls01210  2-Oxocarboxylic acid metabolism
ecls01230  Biosynthesis of amino acids
Module
ecls_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecls_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ecls00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LI67_009865
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LI67_009865
Enzymes [BR:ecls01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     LI67_009865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AKZ73033
LinkDB All DBs
Position
1:1901906..1903156
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPAEGKKITLQNGKINVPHNPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEIYTGEKSTQVYGQDVWLPAETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSADAEKVIKFLR
EEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEGA
FKDWGYQLAKEEFGGELIDGGPWQKIKNPNTGKEIVIKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMEWFEAADLIVKGMEGAINAKTVTYDFERLMEGAKLLKCSEFGDAIIANM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcggaaggtaaaaagatcaccctgcaaaacggcaag
attaacgttcctcacaatccgatcattccattcatcgaaggtgatggtatcggtgtagac
gttaccccggcaatgctgaaagtggttgatgccgctgttgagaaagcctacaaaggcgag
cgtaaaatttcctggatggaaatttacaccggtgagaaatcgacgcaagtttatggccag
gacgtctggctgccagcagaaacgctggacctgatccgcgactaccgcgttgctatcaaa
ggcccactgacgacgccagttggcggcggcatccgttccctgaacgtggcactgcgtcag
gagctggacctgtacgtctgtctgcgtccggttcgttactatcagggcaccccaagcccg
gttaagcacccagaactgaccgacatggtcatcttccgcgaaaactcagaagacatctac
gcgggtatcgaatggaaagcggactctgctgatgcagagaaagtgattaaattcctgcgc
gaagagatgggcgtgaagaaaattcgcttccctgagcattgcggtatcggcattaagccg
tgctccgaagaagggaccaagcgtctggtgcgcgcggccatcgaatatgcgatcaccaac
gaccgtgactctgtgaccctggttcacaaaggcaacatcatgaagttcaccgaaggcgcg
ttcaaagactggggctaccagttggcgaaagaagagttcggcggtgagctgatcgacggc
ggcccatggcagaagatcaaaaacccgaacaccggcaaagagatcgtcattaaagatgtg
atcgccgatgcgttcctgcagcagatcctgctgcgtcctgcggaatacgacgtgattgcc
tgtatgaacctgaacggtgactacatctctgacgccctggcagctcaggttggcggtatc
ggtatcgcccctggcgcgaacatcggtgacgagtgcgccctgttcgaagcgacccacggt
actgcaccaaaatacgcaggccaggacaaagtgaacccgggctctatcatcctgtccgca
gagatgatgctgcgtcatatggaatggttcgaagccgcagacctgatcgttaaaggtatg
gaaggcgcaatcaacgcgaaaaccgtcacctatgacttcgaacgtctgatggaaggcgct
aagctgctgaaatgttcagagtttggcgacgcgattatcgcgaacatgtaa

DBGET integrated database retrieval system