KEGG   Enterobacter cloacae 34983: LI64_14630Help
Entry
LI64_14630        CDS       T03709                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
eclz  Enterobacter cloacae 34983
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eclz00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    LI64_14630
Enzymes [BR:eclz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LI64_14630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3087174..3088802
Genome map
AA seq 542 aa AA seqDB search
MTIHDPRFSDVIIIGGGATGAGIARDCALRGLSVTLLERHDIATGATGRNHGLLHSGARY
AVTDAESARECIAENQILRRIARHCVEPTNGLFITLPEDDLAFQQTFITACTAAGIQAEA
IDPVQARRLEPSVNPALLGAVKVPDGTVDPFRLTAANMLDAREHGAQILTGHHVTGLIRE
GNTVRGVRVFDAQYNEHRELYAAVVVNAAGIWGQRIAEYADLSIRMFPAKGSLLILDHRI
NNHVINRCRKPSDADILVPGDTISLIGTTSMHVDYSDIDVNRVTAEEVDILLREGEKLAP
VMAQTRILRAYAGVRPLVASDNDPSGRNVSRGIVLLDHAERDGMDGFITITGGKLMTYRL
MAQWATDAVCRKLGNTTPCVTADKALPGSQQSTEKTLHKIISLPAPLRGSAIYRHGDRTP
TWLGEGRLSRSLVCECEAVTAGEVQYAVENLTVNNLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFHATTSTQSLAQLSDFLNERWKGIQPVAWGDALRESEFTRWVYQGLCGLEKEHNH
EI
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgacaattcacgatccacgcttcagcgatgtgattatcattggcggtggcgcaacgggt
gccggcatcgcacgcgactgcgccctgcggggattgagcgtcacgcttctggagcgccac
gatatcgccaccggcgcaacggggcgtaatcacggcctgctgcacagcggtgcgcgctat
gcggtcactgatgcggaatccgcgcgcgagtgtatcgctgaaaaccagatcctcagacgc
atcgcccgccactgcgttgaacccaccaacggcctgtttattacccttcccgaagatgac
ctcgcctttcagcaaacctttatcaccgcctgtacggcggcaggcattcaggctgaagcg
atcgatcctgtgcaggcacgccgtcttgaaccctcggtaaacccggcgttactgggcgcg
gtgaaagtgcctgacggcaccgttgatcccttccgcctgaccgccgccaatatgctcgac
gcgcgggaacatggcgcacagatcctgaccgggcatcacgtcaccgggcttattcgtgaa
ggtaatacggtgcgcggggtgcgcgtgtttgatgcgcagtacaacgaacaccgcgagctg
tatgccgccgtcgtggtcaatgcggcagggatctggggccagcgcatcgcggaatatgcc
gatttatccatccgcatgttcccggcgaaaggctcgctgctgatcctcgatcaccgcatc
aataaccatgttatcaaccgctgccgcaaaccgtccgatgccgacatcctggtaccgggc
gacaccatttctctgattggcaccacgtcaatgcacgttgactacagcgatattgacgtt
aaccgggtcaccgccgaagaggtcgacattctgctgcgcgaaggggaaaagctggccccg
gtgatggcgcagacgcgtattctgcgtgcctacgcgggcgtgcgtcccctcgtcgccagc
gacaacgacccgagcgggcgtaacgtcagccgcggcatcgtgctgctcgatcacgccgag
cgcgacggcatggacggatttatcaccatcaccggcggcaagctgatgacctaccggctg
atggcccagtgggccaccgatgccgtctgccgtaagctcggcaacaccacgccgtgcgtg
acggcggacaaggccctgcccggttcgcagcaatcgacagaaaaaacgctgcacaaaatc
atttcacttcctgccccgcttcgcggttcagctatttaccgccacggcgaccgcacgcca
acctggctcggtgaaggccgactcagccgcagcctggtgtgcgaatgcgaagccgtgacc
gcaggcgaggtgcaatatgccgtggaaaacctgacggtgaacaacctgctcgatttacgc
cgccgcacgcgcgtcgggatgggcacctgtcagggggagctgtgcgcctgccgtgccgcc
ggattgctgcaacgttttcacgccacgacgtcaacccagtcgcttgcacagctcagcgat
tttttaaacgagcgctggaaaggcatacagcccgtcgcgtggggggatgccctgcgcgaa
agcgagtttacccgctgggtctatcaggggctttgcggtctggagaaggagcacaaccat
gaaatttga

DBGET integrated database retrieval system