KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_3163Help
Entry
EcSMS35_3163      CDS       T00672                                 

Gene name
sodC_2
Definition
(GenBank) superoxide dismutase (Cu-Zn)
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Brite
Enzymes [BR:ecm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     EcSMS35_3163 (sodC_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3245951..3246475)
Genome map
AA seq 174 aa AA seqDB search
MKRKLIAFVILATSSCGYAATKDVTMNLVDSDGKERNIGKITIQKTPYGLLFTPDLHSLP
AGIHGFHVHENASCAPALKDGKTVAALSAGGHFDPEKTGKHLGPWSPDGHLGDLPALYVT
HDGKATYPVLAPRLSELKELDGRSLMLHAGGDNHDDHPEPLGGGGARIACGIIP
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtaaacttattgcctttgtgattctggctacatcatcctgtggatatgcagcc
accaaagatgtaacaatgaatcttgttgatagtgacggaaaagagcgaaatattggtaaa
ataaccatccagaagacaccctacgggctgctgttcactcctgatcttcactccttaccc
gccggcattcatggttttcatgtacatgaaaacgcaagttgtgctcctgccctgaaagat
ggaaaaactgtcgctgctttatctgcaggtggtcactttgacccggaaaaaacagggaag
catctcggtccatggtctcctgatggccacctaggtgatctccctgcgctttatgtcact
catgacggaaaagcaacctacccggtgcttgcgccaagactatctgaattaaaggagctc
gatggccgttcgctaatgctccacgcaggaggtgataatcatgatgaccatcctgaacct
ctaggtggcggtggtgcaagaattgcctgtggtatcatcccataa

DBGET integrated database retrieval system