KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_3260Help
Entry
EcSMS35_3260      CDS       T00672                                 

Definition
(GenBank) AMP-binding enzyme
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Brite
Enzymes [BR:ecm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     EcSMS35_3260
Lipid biosynthesis proteins [BR:ecm01004]
 Acyl-CoA synthetase
  Unknown
   EcSMS35_3260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
3338775..3340466
Genome map
AA seq 563 aa AA seqDB search
MRYADFPTLVDALDYAALSSAGMNFYDRRCQLEDQLEYQTLKARAEAGAKRLLSLNLKKG
DRVALIAETSSGFVEAFFACQYAGLVAVPLAIPMGVGQRDSWSAKLQGLLASCQPAAIIT
GDEWLPLVNAATHNNNPELHVLSHAWFKALPEADVALQRPVPNDIAYLQYTSGSTRFPRG
VIITHREVMANLRAISHDGIKLRPGDRCVSWLPFYHDMGLVGFLLTPVATQLSVDYLRTQ
DFAMRPLQWLKLISKNRGTVSVAPPFGYELCQRRVNEKDLAELDLSCWRVAGIGAEPISA
EQLHQFAECFRQVNFDDKTFMPCYGLAENALAVSFSDEASGVVVNEVDRDILEYQGKAVA
PDAETRAVSTFVNCGKALPEHGIEIRNEAGIPVAERVVGHICISGPSLMSGYFGDQISQD
EIAATGWLDTGDLGYLLDGYLYVTGRIKDLIIIRGRNIWPQDIEYIAEQEPEIHSGDAIA
FVTAQEKIILQIQCRISDEERRGQLIHALAARIQSEFGVTADIDLLPPHSIPRTSSGKPA
RAEAKKRYQKAYAASLHVQESLA
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatgccgattttccaacgctggttgatgctttggactatgccgctctgagtagc
gctggaatgaatttttatgacagacgttgccaacttgaagatcaactggaatatcagacg
ttaaaagcgcgtgccgaagctggtgcgaagcggttgttatcgctaaacctgaaaaaaggc
gatcgcgtggcgctgattgccgaaaccagtagcgggttcgtagaggctttttttgcctgc
cagtatgccggcttagtcgccgtcccgttggcgattcccatgggcgtcggtcagcgggat
tcctggagcgccaagctgcagggtttactggcaagttgccagcccgcagccattatcact
ggtgatgagtggttgccactggtcaatgccgcgacgcataacaacaaccccgaattacat
gttttaagccacgcctggtttaaggcattaccggaagccgatgttgcgctccagcgtcca
gttccgaacgatatcgcctacctccagtacacctccggcagcacccgttttccccgtggc
gtcattatcacccatcgcgaagtgatggctaatctacgtgctataagccacgatggcata
aaattacgccctggcgaccgctgcgtctcctggctgcctttctaccatgatatgggactg
gtcggctttctcctgacccccgtcgccacgcagctttcagtagattatttgcgcactcag
gattttgccatgcgtcctctgcaatggcttaaattgatcagtaaaaatcgcggcaccgtt
tccgttgcgccgccgtttggctatgaattgtgccagcgccgcgtgaatgaaaaagatctc
gctgaactggatctttcctgctggcgcgtcgctggtattggtgcagaacccatctccgca
gaacaactccatcaattcgctgaatgtttccgtcaggtcaactttgacgataaaactttc
atgccgtgctacggactggcagaaaatgcgctggctgtcagcttctctgatgaagcttcc
ggggttgtggttaacgaagtggatcgcgacatcctcgaatatcagggcaaagccgtcgcg
ccggatgctgaaacacgcgccgtatcgactttcgtcaactgcggtaaagcgttgccggaa
catggcattgaaatccgcaatgaagcaggtatacctgtcgcggaacgtgtggtaggccat
atttgcatctccggccctagcctgatgagcggttactttggcgaccagatttcacaagac
gagattgccgcgacgggctggttagacaccggcgacctcggttatctgctggacggttat
ctgtatgtcaccggacgcattaaagatctgattattattcgtggccgtaatatctggccg
caggatattgaatatattgcggaacaggaaccggaaattcattctggcgatgcgattgct
tttgttaccgcccaggaaaaaatcattttgcagatccagtgtcggatcagcgatgaagaa
cgtcgcgggcagcttatccacgcgctggcagcacggatccaaagcgaatttggcgttacc
gcggatatcgatctgttgccgccccacagtattccccgaacatcctccggcaagcctgcc
cgtgcggaagcgaaaaaacgttatcagaaggcttatgctgccagtcttcatgtgcaggag
tctctggcatga

DBGET integrated database retrieval system