KEGG   Escherichia coli APEC O78: APECO78_21665Help
Entry
APECO78_21665     CDS       T02445                                 

Gene name
malS
Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
ecoa  Escherichia coli APEC O78
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecoa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    APECO78_21665 (malS)
Enzymes [BR:ecoa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     APECO78_21665 (malS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
4492557..4494587
Genome map
AA seq 676 aa AA seqDB search
MKLAACFLTLLPGFAVATSWTSPGFPAFSEQGTGTFVSHAQLPKGTRPLTLNFDQQCWQP
ADAIKLNQMLSLQPCSNTPPQWRLFRDGEYTLQIDTRSGTPTLMISIQNAAEPVASLVRE
CPKWDGLPLTVDVSATFPEGAAVRDYYSQQIAIVKNGQITLQPAATSNGLLLLERAETDT
SAPFDWHNATVYFVLTDRFENGDPSNDQSYGRHKDGMTEIGTFHGGDLRGLTNKLDYLQQ
LGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGNEADLRTLVDSA
HQRGIRILFDVVMNHTGYATLADMQEYQFGALYLSGDEVKKTLGERWSDWKPAAGQTWHS
FNDYINFSDKTGWDKWWGKNWIRTDIGDYDNPGFDDLTMSLAFLPDIKTESTTASGLPVF
YKNKTDTHAKVIEGFTPRDYLTHWLSQWVRDYGIDGFRVDTAKHVELPAWQQLKTEASAA
LREWKKANPDKALDDKPFWMTGEAWGHGVMQSDYYRHGFDAMINFDYQEQAAKAVDCLAQ
MDTTWQQMAEKLQGFNVLSYLSSHDTRLFREGGDKAAELLLLAPGAVQIFYGDESSRPFG
PTGSDPLQGTRSDMNWQDVSGKSAANVAHWQKISQFRARHPAIGAGKQTTLSLKQGYGFV
REHGDDKVLVIWAGQQ
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgccgcctgttttctgacactccttcctggcttcgccgttgccaccagctgg
acttctccggggtttcccgcctttagcgaacaggggacaggaacatttgtcagccacgcg
cagttgcccaaaggtacgcgtccactaacgctaaattttgaccaacagtgctggcagcct
gcggatgcgataaaactcaatcagatgctttccctgcaaccttgtagcaacacgccgcct
caatggcgattgttcagggacggcgaatatacgctgcaaatagacacccgctccggtacg
ccaacattgatgatttccattcagaacgccgccgaaccggtagcaagcctggtccgtgaa
tgcccgaaatgggatggattaccgctcacagtggatgtcagcgccactttcccggaagga
gccgccgtacgggattattacagccagcaaattgcgatagtgaagaacggtcaaataacg
ttacaacccgctgctaccagcaacggtttactcctgctggaacgggcagaaactgacaca
tccgcccctttcgactggcataacgccacggtttactttgtgctgacagatcgtttcgaa
aacggcgatcccagtaatgaccagagttacggacgtcataaagacggtatgacggaaatt
ggcacttttcacggcggcgatttacgcggcctgaccaacaaactggattacctccagcag
ttgggcgttaatgctttatggataagcgccccatttgagcaaattcacggctgggtcggc
ggcggtacaaaaggcgatttcccgcattatgcctaccacggttattacacacaggactgg
acgaatcttgatgccaatatgggcaacgaagccgatctacggacgctggttgatagcgca
catcagcgcggtattcgtattctctttgatgtcgtgatgaaccacaccggctatgccacg
ctggcggatatgcaggagtatcagtttggcgcgttatatctttctggtgacgaagtgaaa
aaaacgctgggtgaacgctggagcgactggaaacctgccgccgggcaaacctggcatagc
tttaacgattacattaatttcagcgacaaaacaggctgggataaatggtggggaaaaaac
tggatcagaacggatatcggcgattacgacaatcctggatttgacgatctcactatgtcg
ctggcctttttgccggatatcaaaaccgaatcaactaccgcttctggtctgccggtgttc
tataaaaacaaaacggatactcacgctaaagtcatcgaaggctttacacctcgcgattac
ttaacccactggttaagtcagtgggtccgcgactatgggattgatggttttcgggtcgat
accgccaaacatgttgagttgcccgcctggcagcaactgaaaaccgaagccagcgccgcg
cttcgcgaatggaaaaaagctaaccccgacaaagcattagatgacaaacctttctggatg
accggtgaagcctggggccacggcgtgatgcaaagtgactactatcgccacggcttcgat
gcgatgatcaatttcgattatcaggagcaggcggcgaaagcagtcgattgtctggcgcag
atggatacgacctggcagcaaatggcggagaaattgcagggtttcaacgtgttgagctac
ctctcgtcgcatgatacccgtctgttccgtgaagggggcgacaaagcagcagagttatta
ctattagcgccaggcgcggtacaaatcttttatggcgatgaatcctcgcgtccgttcggt
cctacaggttctgatccgctgcaaggtacacgttcggatatgaactggcaggatgttagc
ggtaaatctgccgccaacgtcgcgcactggcagaaaatcagccagttccgcgcccgccat
cccgcaattggcgcgggcaaacaaacgacactttcgctgaagcagggctacggctttgtt
cgtgagcatggcgacgataaagtgctggtcatctgggctgggcaacagtga

DBGET integrated database retrieval system