KEGG   Escherichia coli K-12 MDS42: ECMDS42_3347Help
Entry
ECMDS42_3347      CDS       T02541                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase, Mn
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ecok  Escherichia coli K-12 MDS42
Brite
Enzymes [BR:ecok01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ECMDS42_3347 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
3530023..3530643
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKA
AASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQN
RRPDYIKEFWNVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagctataccctgccatccctgccgtatgcttacgatgccctggaaccgcacttcgat
aagcagaccatggaaatccaccacaccaaacaccatcagacctacgtaaacaacgccaac
gcggcgctggaaagcctgccagaatttgccaacctgccggttgaagagctgatcaccaaa
ctggaccagctgccagcagacaagaaaaccgtactgcgcaacaacgctggcggtcacgct
aaccacagcctgttctggaaaggtctgaaaaaaggcaccaccctgcagggtgacctgaaa
gcggctatcgaacgtgacttcggctccgttgataacttcaaagcagaatttgaaaaagcg
gcagcttcccgctttggttccggctgggcatggctggtgctgaaaggcgataaactggcg
gtggtttctactgctaaccaggattctccgctgatgggtgaagctatttctggcgcttcc
ggcttcccgattatgggcctggatgtgtgggaacatgcttactacctgaaattccagaac
cgccgtccggactacattaaagagttctggaacgtggtgaactgggacgaagcagcggca
cgttttgcggcgaaaaaataa

DBGET integrated database retrieval system