KEGG   Escherichia coli LY180: LY180_02765Help
Entry
LY180_02765       CDS       T02846                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
ecol  Escherichia coli LY180
Pathway
ecol00220  Arginine biosynthesis
ecol00250  Alanine, aspartate and glutamate metabolism
ecol00471  D-Glutamine and D-glutamate metabolism
ecol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecol00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LY180_02765
   00220 Arginine biosynthesis
    LY180_02765
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    LY180_02765
Enzymes [BR:ecol01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     LY180_02765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-GeneID: 16978227
NCBI-ProteinID: AGW07929
LinkDB All DBs
Structure
PDB: 

Jmol
Position
583268..584200
Genome map
AA seq 310 aa AA seqDB search
MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDGKVYSAGDSDY
RFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIALELHGGKPLSPLVNAGA
IATTSLINAENVEQRWQRILHIQQQLAGEQVALSDEVNQSEQTTNFHNRAIAWLLYSAGY
LYCDAMEACDVYTRQCSTLLNTVELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMM
EGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEEGNSVRGQKMVASVA
KQLGYNVFKG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaacaaattacagcaggcagtggatcaggcttacacccaatttcactca
cttaacggcggtcaaaatgccgactacattccctttctggcgaatgtgcctggtcaactg
gcggcagtggctatcgtgacctgcgatggcaaggtctatagtgcgggtgacagtgattac
cgctttgcgctggaatccatctcgaaagtctgtacgttagcccttgcgttagaggatgtc
ggcccgcaggcggtacaggacaaaattggcgctgacccgaccggattgccctttaactca
gttatcgccttagagttgcatggcggcaaaccgctttcgccactggtaaatgctggcgcc
attgccaccaccagcctgattaacgctgaaaatgttgaacaacgctggcagcgaatttta
catatccaacagcaactggctggtgagcaggtagcgctctctgacgaagtcaaccagtcg
gaacaaacaaccaacttccataaccgggccattgcctggctgctgtactccgccggatat
ctctattgtgatgcaatggaagcctgtgacgtgtacacccgtcagtgctccacgctcctc
aatactgttgaactggcaacacttggcgcgacgctggcggcggggggagtgaatccgctg
acgcataaacgcgttcttcaggccgataacgtgccgtacattctggccgaaatgatgatg
gaagggctgtatggtcgctccggtgactgggcatatcgcgttggtttaccgggcaaaagc
ggtgtaggtggcggtattctggcggtcgtccctggtgtgatgggaattgccgcgttctca
ccaccgctggacgaagaaggcaacagtgttcgcggtcaaaaaatggtggcatcggtcgct
aagcaactcggctataacgtgtttaagggctga

DBGET integrated database retrieval system