KEGG   Escherichia coli O145 H28 RM13514 (EHEC): ECRM13514_1139Help
Entry
ECRM13514_1139    CDS       T03010                                 

Definition
(GenBank) Superoxide dismutase [Cu-Zn] precursor
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ecoo  Escherichia coli O145:H28 RM13514 (EHEC)
Brite
Enzymes [BR:ecoo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ECRM13514_1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1160512..1161171)
Genome map
AA seq 219 aa AA seqDB search
MFLSIGIINRSDRILHSYCAISSERCLLPCNQQAQSVNGINEGFMKCKIIAAIAMLTAAS
CGYAAEQEVPMNLVSADGKEVSIGKITIQETPYGLLFTPALHSLSEGIHGFHVHEKGNCA
PALKDGKPVAALSAGGHFDPKNTGKHLGPWSPDGHLGDLPALFVTHDGKANYPVLAPRLN
SLKEIKGRSLMLHAGGDNHHDHPEPLGGGGARMACGIIQ
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgttcctctcaattggtattattaatcgcagtgataggatattgcacagctattgcgcg
atatcatcagaacgctgtttgttaccctgtaaccagcaagctcagtctgttaacggaatt
aatgagggttttatgaaatgtaaaataattgctgccattgccatgctgacagcagcatca
tgcggatacgcagcagaacaggaagtcccaatgaaccttgtcagtgctgacggaaaagaa
gtcagcattggaaaaataaccattcaggagaccccctacggtctgctgttcacaccagcc
cttcactctctgtctgaaggcattcatggttttcatgtgcacgaaaaaggaaattgcgcc
ccggcactgaaagacggaaaaccggtcgcagcattatcggctggcggtcactttgacccg
aaaaacaccggcaaacatcttggcccctggtctccggatggacacctgggcgacctccct
gcgctgttcgtgacgcatgacggaaaagcgaactacccggtcctggccccgagactgaac
tcattaaaagagattaaagggcgttctctcatgcttcatgctggcggtgataaccatcat
gaccatccggagcccctgggcggtggtggtgcgagaatggcctgcggcatcattcaataa

DBGET integrated database retrieval system