KEGG   Escherichia coli O25b K100 H4-ST131 EC958 (UPEC): EC958_0626Help
Entry
EC958_0626        CDS       T04373                                 

Gene name
ybaS
Definition
(GenBank) probable glutaminase YbaS
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
ecos  Escherichia coli O25b:K100:H4-ST131 EC958 (UPEC)
Pathway
ecos00220  Arginine biosynthesis
ecos00250  Alanine, aspartate and glutamate metabolism
ecos00471  D-Glutamine and D-glutamate metabolism
ecos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecos00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EC958_0626 (ybaS)
   00220 Arginine biosynthesis
    EC958_0626 (ybaS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    EC958_0626 (ybaS)
Enzymes [BR:ecos01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     EC958_0626 (ybaS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: CDN80878
UniProt: W8ZFD4
LinkDB All DBs
Structure
PDB: 

Jmol
Position
541960..542892
Genome map
AA seq 310 aa AA seqDB search
MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTSDGNVYSAGDSDY
RFALESISKVCTLALALEDVGPQAVQDKVGADPTGLPFNSVIALELHGGKPLSPLVNAGA
IATTSLINAENTEQRWQRILHIQQQLAGEQVALSDEVNQSEQTTNFHNRAIAWLLYSAGY
LYCDAMEACDVYTRQCSTLINTIELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMM
EGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEEGNSVRGQKMVASVA
KQLGYNVFKG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaacaaattacagcaggcagtggatcaggcttacacccaatttcactca
cttaacggcggacaaaatgccgattacattccctttctggcgaatgtccctggtcaactg
gcggcagtggctatcgtgaccagcgatggcaacgtctatagtgcgggtgacagtgattac
cgctttgcgctggaatccatctcgaaagtctgtacgttagcccttgcgttagaagatgtc
ggcccgcaggcggtacaggacaaagttggcgctgacccgaccggattgccctttaactca
gttatcgccttagagttgcatggcggcaaaccgctttcgccactggtaaatgctggcgct
attgccaccaccagcctgattaacgctgaaaatactgaacaacgctggcagcgaatttta
catatccaacaacaactggctggtgagcaggtagcgctctctgatgaagtcaaccagtcg
gaacaaacaaccaacttccataaccgggccattgcctggctgctgtactcagccggatat
ctctattgtgatgcaatggaagcctgtgacgtgtacacccgtcagtgctccacgctcatc
aatactattgaactggcaacgcttggcgcgacgctggcggcgggtggtgtgaatccgctg
acgcataaacgcgttcttcaggccgacaatgtgccgtacattctggccgaaatgatgatg
gaagggctgtatggtcgctccggtgactgggcgtatcgcgttggtttaccgggcaaaagc
ggtgtaggtggcggtattctggcggtcgttcctggcgtgatgggaattgccgcgttttca
ccaccactggacgaagaaggcaacagtgttcgcggtcaaaaaatggtggcatcggtcgct
aagcaactcggctataacgtgtttaagggctga

DBGET integrated database retrieval system