KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs1120Help
Entry
ECs1120           CDS       T00048                                 

Definition
(RefSeq) copper/zinc-superoxide dismutase
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Brite
Enzymes [BR:ecs01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ECs1120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1202676..1203203)
Genome map
AA seq 175 aa AA seqDB search
MKCKIIAAIAMLTAASCGYAAEQEVPMNLVSADGKEVSIGKITIQETPYGLLFTPALHSL
SEGIHGFHVHEKGNCAPALKDGKPVAALSAGGHFDPKNTGKHLGPWSPDGHPGDLPALFV
THDGKANYPVLAPRLNSLKEIKGRSLMLHAGGDNHHDHPEPLGGGGARMACGIIQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgtaaaatcattgctgccattgccatgctgacagcagcatcatgcggatacgca
gcagaacaggaagtcccaatgaaccttgtcagtgctgacggaaaagaagtcagcattgga
aaaataaccattcaggagaccccctacggtctgctgttcacaccagcccttcactctctg
tctgaaggcattcatggttttcatgtgcacgaaaaaggaaattgcgccccggcactgaaa
gacggaaaaccggtcgcagcattatcggctggcggtcactttgacccgaaaaacaccggc
aaacatcttggcccctggtctccggatggacacccgggcgacctccctgcgctgttcgtg
acgcatgacggaaaagcgaactacccggtcctggccccgagactgaactcattaaaagag
attaaagggcgttctctcatgcttcatgctggcggtgataaccatcatgaccatccggag
cccctgggcggtggtggtgcgagaatggcctgcggcatcattcaataa

DBGET integrated database retrieval system