KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs1879Help
Entry
ECs1879           CDS       T00048                                 

Definition
(RefSeq) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00250  Alanine, aspartate and glutamate metabolism
ecs00410  beta-Alanine metabolism
ecs00640  Propanoate metabolism
ecs00650  Butanoate metabolism
ecs01100  Metabolic pathways
ecs01120  Microbial metabolism in diverse environments
Module
ecs_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecs00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECs1879
   00650 Butanoate metabolism
    ECs1879
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECs1879
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECs1879
Enzymes [BR:ecs01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ECs1879
Amino acid related enzymes [BR:ecs01007]
 Aminotransferase (transaminase)
  Class III
   ECs1879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 912688
NCBI-ProteinID: NP_309906
UniProt: Q8X7G8
LinkDB All DBs
Position
1873358..1874623
Genome map
AA seq 421 aa AA seqDB search
MSNNEFHQRRLSATPRGVGVMCNFFAQSAENATLKDVEGNEYIDFAAGIAVLNTGHRHPD
LVAAVEQQLQQFTHTAYQIVPYESYVTLAEKINALAPVSGQAKTAFFTTGAEAVENAVKI
ARAHTGRPGVIAFSGGFHGRTYMTMALTGKVAPYKIGFGPFPGSVYHVPYPSDLHGISTQ
DSLDAIERLFKSDIEAKQVAAIIFEPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEV
QSGFARTGKLFAMDHYADKPDLMTMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGN
PLAVAAAHAVLNIIDKESLCERAMQLGQRLTKTLIDAKENVPAIAAVRGLGSMIAAEFND
PQTGEPSAAIAQKIQQRALAQGLLLLTCGAYGNVIRFLYPLTIPDAQFDAAMKILQDALR
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaatgaattccatcagcgtcgtctttctgccaccccgcgcggggttggcgtg
atgtgtaacttcttcgcccagtcggctgaaaacgccacgctgaaggatgttgagggcaac
gagtacatcgatttcgccgcaggcattgcggtgctgaataccggacatcgccaccctgat
ctggtcgcggcggtggagcagcagctgcaacagtttacccacaccgcgtatcagattgtg
ccatatgaaagctacgtcaccctggcggagaaaatcaacgcccttgccccggtgagcggg
caggccaaaaccgcgttcttcaccaccggtgcggaagcggtggaaaacgcggtgaaaatc
gcccgcgcccataccggacgccctggcgtgattgcgtttagcggcggcttccacggtcgt
acgtatatgactatggcgttaactggaaaggtcgcgccgtacaaaatcggcttcggcccg
ttccctggttcggtgtatcacgtaccttatccgtcagatttacacggcatttcaacacag
gactccctcgacgccatcgaacgcttgtttaaatcagacatcgaagcgaagcaggtcgcg
gccattattttcgaaccggtgcagggcgagggcggtttcaacgttgcgccaaaagagctg
gttgccgccattcgccgcctgtgcgacgagcacggtattgtgatgattgccgatgaagtg
caaagcggctttgcgcgtaccggcaaactgtttgcgatggatcattacgccgataagccg
gacttaatgacgatggcgaaaagcctcgcgggcgggatgccgctttcgggtgtggtcggt
aacgcgaatattatggacgcgcccgcgccgggcgggcttggcggcacctacgccgggaat
ccgctggcggtggctgccgcgcacgcggtgctcaacattatcgacaaagagtcactctgt
gagcgcgccatgcagttgggacagcgtctgacgaaaaccctgattgatgccaaagaaaac
gttccggccatcgcggcggtacgtggtctgggctcgatgattgcggcagaatttaacgac
ccgcaaacgggcgagccgtcagccgccattgcgcaaaaaattcagcaacgcgcgctggcg
cagggactgcttctactgacctgtggcgcatacggcaacgtgattcgtttcctgtatccg
ctgaccatcccggatgcgcaattcgatgcggcaatgaaaattttgcaggatgcgctgaga
gattaa

DBGET integrated database retrieval system