KEGG   Escherichia coli APEC O1 (APEC): APECO1_3858Help
Entry
APECO1_3858       CDS       T00425                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00250  Alanine, aspartate and glutamate metabolism
ecv00280  Valine, leucine and isoleucine degradation
ecv00410  beta-Alanine metabolism
ecv00640  Propanoate metabolism
ecv00650  Butanoate metabolism
ecv01100  Metabolic pathways
ecv01120  Microbial metabolism in diverse environments
Module
ecv_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    APECO1_3858 (gabT)
   00650 Butanoate metabolism
    APECO1_3858 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    APECO1_3858 (gabT)
   00280 Valine, leucine and isoleucine degradation
    APECO1_3858 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    APECO1_3858 (gabT)
Enzymes [BR:ecv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     APECO1_3858 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     APECO1_3858 (gabT)
Amino acid related enzymes [BR:ecv01007]
 Aminotransferase (transaminase)
  Class III
   APECO1_3858 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABJ02097
UniProt: A0A0H2Z228
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2962615..2963901
Genome map
AA seq 428 aa AA seqDB search
MRMSSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHL
HPKVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENA
VKIARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGI
SEDDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIA
DEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTY
AGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHTEIGDVRGLGAMIAIE
LFEDGDHSKPDAKLTAEIVARARDKGLILLSCGPYNNVLRILVPLTIEDAQIRQGLEIIS
QCFAEAKQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatgagcagcaataaagagttaatgcagcgccgcagtcaggcgattccccgtggc
gttgggcaaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgtt
gaaggccgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctg
catccgaaagtggttgcggcggtggaagcgcagttgaaaaaactgtcgcacacctgcttc
caggtgctggcttacgagccgtatcttgaactgtgcgagattatgaatcagaaggtgccg
ggcgattttgccaagaaaactctgctggttacgaccggttccgaagcggtggaaaatgcg
gtgaaaatcgcccgcgccgccactaaacgtagcggtactatcgcctttagcggtgcgtat
cacgggcgcacgcattacacactggcgctgaccggcaaggtgaatccatactctgcgggc
atggggctgatgccgggtcatgtttatcgcgcgctttatccttgcccgctgcacggcata
agcgaggatgacgctatcgccagcatccaccggatcttcaaaaatgacgccgcgccggaa
gatatcgccgccatcgtgattgagcccgttcagggcgaaggcggtttctacgccgcgacg
ccagcctttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgcc
gatgaagtgcagagcggcgcagggcgtaccggcacgctgtttgcgatggagcaaatgggc
gtggcaccagatctcaccacctttgcgaaatcgatcgcgggcggcttcccgctggcgggc
gtcaccgggcgcgcggaagtgatggatgccgtcgctccaggcggtctgggcggcacctat
gccggtaacccgattgcctgcgtagcggcgctggaagtgttaaaagtgtttgagcaggaa
aatctgctgcaaaaagccaacgatctggggcagaaactgaaagacggattgctggcgata
gccgaaaaacatactgagatcggcgacgtacgcgggctgggagcgatgattgccatcgag
ctgtttgaagatggcgatcacagcaaaccggacgccaaactcaccgccgagatcgtggcg
cgtgcccgcgataaaggcctgattcttctctcctgcggcccgtataacaacgtgctgcgc
atccttgtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagc
cagtgttttgctgaggcgaagcagtag

DBGET integrated database retrieval system