KEGG   Escherichia coli E24377A (ETEC): EcE24377A_2162Help
Entry
EcE24377A_2162    CDS       T00590                                 

Gene name
amyA
Definition
(GenBank) alpha-amylase, cytoplasmic
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
ecw  Escherichia coli E24377A (ETEC)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EcE24377A_2162 (amyA)
Enzymes [BR:ecw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     EcE24377A_2162 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2133217..2134704
Genome map
AA seq 495 aa AA seqDB search
MRNPTLLQCFHWYYPEGGKLWPELAERADGFNDIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSIPTKYGDKAQLLAAIDALKRNDIAVLLDVVVNHKMGADEKEAIRVQRV
NADDRTQIDEEIIECEGWTRYTFPARAGQYSQFIWDFKCFSGIDHIENPDEDGIFKIVND
YTGEGWNDQVDDELGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTQCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVDKLQTYIDQVEGKTMLFDAPLQMKFHEAS
RMGRDYDMTQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEPWFKPLAYALILLREN
GVPSVFYPDLYGAHYEDVGGDGQTYPIDMPIIEQLDELILARQRFAHGVQTLFFDHPNCI
AFSRSGTDEYPGCVVVMSNGDDGEKTIHLGENYGNKTWRDFLGNRQESVVTDENGEATFF
CNGGSVSVWVIEEVI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatcccacgctgttacaatgttttcactggtattacccggaaggcggtaagctc
tggcctgaactggccgagcgcgccgacggttttaatgatattggtatcaatatggtctgg
ttgccgcccgcctataaaggcgcatcgggcgggtattcggtcggctacgactcctatgat
ttatttgatttaggcgagtttgatcagaaaggcagcatccccactaaatatggcgataaa
gcacaactgctggccgccattgatgctctgaaacgtaatgacattgcggtgctgttggac
gtggtagtcaaccacaaaatgggcgcggatgaaaaagaagctattcgcgtgcagcgtgta
aatgctgatgaccgtacgcaaattgacgaagaaatcattgagtgtgaaggctggacgcgt
tacaccttccccgctcgtgccgggcaatactcgcagtttatctgggatttcaaatgtttt
agcggtatcgaccatatcgaaaaccctgatgaagatggcatatttaaaattgttaacgac
tacaccggcgaaggctggaacgatcaggttgatgatgaattaggtaatttcgattatctg
atgggcgagaatatcgatttccgcaatcatgccgtgacggaagagattaaatactgggcg
cgctgggtgatggaacaaacgcaatgcgacggttttcgtcttgatgcggtcaaacatata
ccggcatggttttataaagagtggatcgaacacgtacaagaagttgcgccaaagccgctg
tttattgtggcggagtactggtcgcatgaagttgataagctgcaaacgtatattgatcag
gtggaaggcaaaaccatgctgtttgatgcgccgctgcagatgaaattccatgaagcatcg
cgcatggggcgcgactacgacatgacgcagattttcacgggtacattagtggaagccgat
cctttccacgccgtgacgctcgttgccaatcacgacacccaaccgttgcaagccctcgaa
gcgccggtcgaaccgtggtttaaaccgctggcgtatgctctaattttgttgcgggaaaat
ggcgttccttcggtgttctatccggacctctacggtgcgcattacgaagatgtcggtggt
gacgggcaaacctatccaatagatatgccaataatcgaacagcttgatgagttaattctc
gcccgtcagcgtttcgcccacggtgtacagacgttatttttcgaccatccgaactgcatt
gcctttagccgcagtggcaccgacgaatatcccggctgcgtggtggtcatgtcgaacggg
gatgatggcgaaaaaaccattcatctgggagagaattacggcaataaaacctggcgtgat
tttctggggaaccggcaagagagcgtagtaaccgacgaaaacggcgaagcgaccttcttt
tgcaacggcggcagcgtcagcgtgtgggttatcgaagaggtgatttaa

DBGET integrated database retrieval system