KEGG   Edwardsiella sp. LADL05-105: AAZ33_16160Help
Entry
AAZ33_16160       CDS       T04005                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
edl  Edwardsiella sp. LADL05-105
Pathway
edl00564  Glycerophospholipid metabolism
edl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:edl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AAZ33_16160
Enzymes [BR:edl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AAZ33_16160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored DAO_C Thi4 NAD_binding_8 Pyr_redox_2 3HCDH_N HI0933_like Pyr_redox_3 GIDA K_oxygenase Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AKR78899
LinkDB All DBs
Position
complement(3637643..3639292)
Genome map
AA seq 549 aa AA seqDB search
MLQSPASQETDVVIIGGGATGAGIARDCARRGLRCILLERHDIATGATGRNHGLLHSGAR
YAVTDGESARECIEENRILKRIARHCVERTDGLFITLPEDDLAYQPHFIEACRAAGIDAE
AIEPAEALRLEPAANPNLLGAVRVPDGTVDPFRLTAANMLDAREHGAQALTYHEVCGLLR
QGDRVTGVRVIDHKSRQRYDIHAQIVVNAAGIWGQHIAEYADLRIKMFPAKGALLILGHR
INNMVINRCRKPADADILVPGDTISLIGTTSTHVDYDQIDNMIVTPQEVDILIREGEKLA
PKLAATRILRAYAGVRPLVASDDDPSGRNVSRGIVLLDHAVRDGLEGFITITGGKLMTYR
LMAEWATDKVCEKLGVTTPCTTASEPLPGSEQSAEETLRKVISLPAPIRGSAVYRHGDRA
DRLLNGDRLNSSLVCECEAVTAGEVRYAVDSLTVNNLVDLRRRTRVGMGTCQGELCACRA
AGLLNRFKITTPQQSIDQLSHFLNERWKGIRPIAWGDALRESEFTSWVYQGLCGMDAALP
QRGESDDEI
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgttacagagccccgcatcacaggaaactgacgtcgtcattatcggcggcggcgccacc
ggcgccggcatcgcccgtgactgcgcgcgtcgcggcctgcgttgcattctgctggagcgc
cacgacatcgccaccggtgcgaccggccgtaaccatggtttgctgcacagcggcgcccgt
tatgcggtgaccgacggtgagtccgcgcgcgaatgtattgaagagaaccgtattcttaag
cgcatcgcccgccactgcgtcgagcgcaccgacggactgtttatcacgctaccggaagac
gatttggcctatcagccgcactttattgaggcctgccgcgccgcgggtatcgatgccgaa
gccatcgaaccggccgaggcgctgcgtctggagcctgccgccaacccgaatctgctgggc
gcggtgcgcgtgccggacggcaccgtcgatcctttccgcctgacggcagccaacatgtta
gatgcgcgtgagcacggcgcccaggcgttgacctatcatgaggtgtgcgggctgctgcgc
cagggcgatcgggtgaccggcgtgcgcgttatcgaccataaatcgcgccagcgctacgac
attcacgcacagatcgtggtgaacgccgccgggatctgggggcagcacatcgccgagtat
gccgatctgcgtatcaagatgttcccggccaagggggcgctgctgatcctgggccaccgt
atcaacaacatggtgatcaaccgctgccgcaagccggcggatgccgatattctagtaccg
ggcgataccatttcgctgatcggtaccacctcgacccacgtcgattacgatcagatagac
aacatgatcgtcacgccgcaggaggtggatattctgatccgtgaaggagagaagctggcg
cccaagctggcggcgacccgcattctgcgcgcctacgccggggtgcgtccgctggtggcc
agcgacgacgatccgagcgggcgtaacgtcagccgtggtattgtgctgctggatcacgcg
gtgcgcgacgggctggagggctttattaccattaccggcggcaagctgatgacctatcgc
ctgatggccgaatgggccaccgataaggtctgtgaaaagctgggtgtcaccaccccctgc
accaccgccagcgagccgctgcccggctctgagcagtcggctgaagagacgctgcgcaag
gtgatttctctgccggcgccgatccgtggctcggcggtttaccgccacggcgatcgcgcc
gatcgcctgctgaacggcgatcgcctcaatagcagcctggtgtgcgaatgcgaggcggtg
accgccggcgaggtgcgctatgcggtggattcgctgacggtgaataacctggtggatctg
cgccgtcgcacccgcgtggggatgggcacctgtcagggcgagctgtgcgcctgccgtgcg
gccggattgctgaaccgatttaagatcaccacgccgcagcagtctatcgatcagctgtcc
cacttcctgaacgaacgctggaaggggatccgcccgatcgcctggggcgatgcactgcgc
gaaagcgaatttaccagttgggtttaccaagggctgtgcgggatggacgccgcgctgccg
cagcgcggggagagcgacgatgaaatttga

DBGET integrated database retrieval system