KEGG   Enterobacter cloacae EcWSU1: EcWSU1_00203Help
Entry
EcWSU1_00203      CDS       T01652                                 

Gene name
tuf1
Definition
(GenBank) Elongation factor Tu 1
  KO
K02358  
elongation factor Tu
Organism
eec  Enterobacter cloacae EcWSU1
Brite
Translation factors [BR:eec03012]
 Eukaryotic Type
  Elongation factors
   EcWSU1_00203 (tuf1)
 Prokaryotic Type
   EcWSU1_00203 (tuf1)
Mitochondrial biogenesis [BR:eec03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    EcWSU1_00203 (tuf1)
Exosome [BR:eec04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   EcWSU1_00203 (tuf1)
  Exosomal proteins of breast cancer cells
   EcWSU1_00203 (tuf1)
  Exosomal proteins of colorectal cancer cells
   EcWSU1_00203 (tuf1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
206752..207936
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GEAEWEEKIIELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgcaatcactaccgttctggctaaaacctac
ggtggttctgctcgtgcattcgaccagatcgataacgcaccagaagaaaaagctcgtggt
atcaccatcaacacctctcacgttgaatatgacaccccgactcgccactacgcacacgta
gactgcccaggccacgccgactatgttaaaaacatgatcaccggtgctgcgcagatggac
ggcgcgatcctggttgttgctgcgactgacggccctatgcctcagactcgtgagcacatc
ctgctgggtcgtcaggtaggcgttccttacatcatcgtgttcctgaacaaatgtgacatg
gttgatgacgaagagctgctggaactggtagagatggaagttcgtgaactgctgtctcag
tacgatttcccaggcgacgacaccccaatcgttcgtggttccgcgctgaaagcgctggaa
ggcgaagcagagtgggaagagaaaatcatcgaactggctggcttcctggattcttacatc
ccagaaccagagcgtgcgattgacaagccgttcctgctgccaatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgttgagcgcggtatcatcaaagttggc
gaagaagttgaaatcgttggtatcaaagagactgctaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgtaggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccaggctcaatcaag
ccacacaccaagttcgaatctgaagtgtatatcctgtccaaagacgaaggcggccgtcat
actccgttcttcaaaggctaccgtccacagttctacttccgtacaactgacgtgaccggt
accatcgaactgccagaaggcgttgagatggtaatgccaggcgacaacatcaagatggtt
gtgacgctgatccacccaatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggt
ggccgtaccgttggcgcgggcgtggttgctaaagttctcggctaa

DBGET integrated database retrieval system