KEGG   Enterobacter cloacae EcWSU1: EcWSU1_04240Help
Entry
EcWSU1_04240      CDS       T01652                                 

Gene name
puuE
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
eec00250  Alanine, aspartate and glutamate metabolism
eec00410  beta-Alanine metabolism
eec00640  Propanoate metabolism
eec00650  Butanoate metabolism
eec01100  Metabolic pathways
eec01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EcWSU1_04240 (puuE)
   00650 Butanoate metabolism
    EcWSU1_04240 (puuE)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EcWSU1_04240 (puuE)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EcWSU1_04240 (puuE)
Enzymes [BR:eec01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     EcWSU1_04240 (puuE)
Amino acid related enzymes [BR:eec01007]
 Aminotransferase (transaminase)
  Class III
   EcWSU1_04240 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEW75668
UniProt: G8LJ42
LinkDB All DBs
Position
complement(4391778..4393043)
Genome map
AA seq 421 aa AA seqDB search
MKNSELNDRRLQATPRGIGVMCNFYADKAENATVWDVEGNEYIDFAAGIAVLNTGHRHPK
VVAAIEKQLHAFTHTAYQIVPYEGYVALAERINQRVPVDGPAKTAFFSTGAEAVENAVKI
ARAYTRRPGLIAFGGAFHGRTFMTMALTGKVAPYKLGFGPFPGSVYHAHYPNDLYGVSTA
EALKSLERIFKADIAPDQVAAIILEPVQGEGGFNIAPADFMQALRELCDTHGILLIADEV
QSGFARTGKLFSMEHHCVKPDLITMAKSLAGGMPLSAVSGRAEVMDAPAPGGLGGTYAGN
PLAIAAAHAVLDVIDEEDLCTRAAHLGHHLVEVLNKAKGDCPFIADIRAQGSMVAVEFND
PQTGLPSPEFTRQVQERALQEGLLLLSCGVYGNVIRFLYPLTIPEVQFRKALDIISASLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaacagtgaactgaatgaccggcgtttgcaggcgacgccgcgcggtatcggcgtg
atgtgtaacttctacgccgataaagccgaaaatgccacggtgtgggacgtcgagggtaac
gagtatatcgacttcgccgccgggattgcggtgctgaataccggccatcggcatccaaaa
gtcgttgccgccatcgaaaaacaactccacgcatttacccatacggcatatcagattgtc
ccgtacgaaggctatgtggcgcttgccgagcgtatcaaccaacgtgtacccgttgatggg
cctgccaaaacggctttcttctctacgggagcagaggcggtcgaaaacgcggtaaaaatt
gcccgcgcgtatacccgtcgtcctggcctgatcgcctttggcggtgccttccacggccgt
acctttatgacgatggcgttgacggggaaagtggcgccgtacaaactcggtttcggtccg
tttccaggatcggtttatcacgcacactatccaaatgatctgtacggcgtcagcacggca
gaagcgttaaaaagcctcgaacgcatcttcaaagcagacattgcgccggaccaggtggcg
gccattatcctggaaccggttcagggggagggggggttcaacattgcccccgccgatttt
atgcaggccctgcgcgaactgtgcgatacgcatggaattttgctgattgccgacgaagtg
caaagtggctttgcgcgaaccggcaagctgttctcgatggaacaccattgcgtgaagccg
gatttgatcaccatggcgaaaagcctggccggcgggatgccgctctcggcggtctcaggc
cgggcggaggtgatggatgcccccgcacctggcgggctgggcgggacttacgccggcaac
ccgctggcgattgccgcagcccatgccgtgctggatgtgattgatgaagaggatctctgc
acgcgcgcggcgcatcttggccatcatctggtggaagtactgaacaaagcgaagggggac
tgtccgtttattgccgatatccgtgcccagggctcaatggtggcggtggagtttaatgac
ccgcaaaccgggctgccgtcgccggaattcacgcgtcaggtccaggagcgtgcgttacag
gaaggtctattgctgctgagctgcggcgtgtacggcaacgttatccgtttcctctatccg
cttaccatccccgaagttcagttccgtaaagcgctggatattatctccgcgtcgctgaca
cgttaa

DBGET integrated database retrieval system