KEGG   Eubacterium eligens: EUBELI_00604Help
Entry
EUBELI_00604      CDS       T00908                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
eel  Eubacterium eligens
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eel00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    EUBELI_00604
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EUBELI_00604
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    EUBELI_00604
Enzymes [BR:eel01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EUBELI_00604
Peptidoglycan biosynthesis and degradation proteins [BR:eel01011]
 Precursor biosynthesis
  Amino acid ligase
   EUBELI_00604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
615852..617000
Genome map
AA seq 382 aa AA seqDB search
MDYINILQLSDNFTKNLQLTKNVNNYVDIVEKFRDKGEIMRIVVLAGGTSTERDVSLVTG
YRVCESLRRNGHEANMLDIFLGVDDSEVKTFFTEKNDLGELSDNLKKKTADIPAEVKRRT
EARESFFGRNVLELCKEADMVFMGLHGSNGEDGKVQATFDLLGIRYTGTDYLSSAISMSK
ELAKKVLVPEGIPMPKGVTLHKGHKIEYVPFPCVVKPCCGGSSVGVSIAHNEKEFEDALD
EAFSYEDTVLVEEFVDGREFSVAVLDGKALPVIEIEPLEGFYDYKNKYKAGSTKETCPAN
IPEDIASQMQFWAEKCCQAAGVTTYARVDELLDKNNNIFCLEINTLPGMTDTSLIPQEAA
AVGISYDELTEKIIEISLAKYE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtggattatataaatatattacaattatctgacaattttacaaaaaatttacaattgacg
aaaaatgtgaataactatgtggatattgtggaaaagttcagggataaaggagaaattatg
agaatagtagttttagcaggtggaacaagtacagaaagagatgtttcattagtcacagga
tacagagtatgcgagagtcttagaagaaacggacatgaagcaaatatgcttgatatcttc
ttaggtgttgatgacagtgaggttaagacattttttacagaaaagaatgatttgggagaa
ctgtctgacaatttaaagaagaaaacagcggacattccggcagaggttaagagaagaaca
gaggcaagagaaagctttttcggacgtaatgtattagaattgtgtaaagaagcagatatg
gtatttatgggacttcatggaagcaatggtgaagatggtaaggtccaggctacatttgat
ctgcttggaatcagatatacaggtacagattatttaagcagtgctatatcaatgagcaag
gaacttgcaaaaaaggttcttgtaccagagggaattcctatgcctaagggtgttacatta
cataaaggacataagattgagtatgttccattcccatgtgttgttaagccttgttgtggt
ggttcaagcgttggtgtttcgatagcacataacgagaaagagtttgaagatgcacttgat
gaagcattttcttatgaagatactgtacttgttgaagagtttgttgacggaagagaattc
tcagttgcggtgcttgatggaaaggcacttccagtaattgagattgagcctcttgaaggc
ttctacgattacaaaaataagtacaaggctggctctactaaggagacatgccctgccaat
attccggaagatattgcaagccagatgcagttctgggcagaaaaatgctgccaggcagca
ggcgtaacaacatacgcaagagttgatgaacttcttgataagaataataatatattctgt
cttgagattaatacacttccaggaatgactgacacaagccttattcctcaggaggcagca
gcagtaggtatatcgtatgatgaacttacagagaagattatcgagatatctcttgcaaag
tatgaatag

DBGET integrated database retrieval system