KEGG   Enterococcus faecalis DENG1: DENG_02491Help
Entry
DENG_02491        CDS       T03043                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
efn  Enterococcus faecalis DENG1
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    DENG_02491 (tdk)
Enzymes [BR:efn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     DENG_02491 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2259487..2260071)
Genome map
AA seq 194 aa AA seqDB search
MAQLFFKYGAMNSGKTIEILKVAHNYEEQDKPVVLMTSGLDTRDGVGKVSSRIGLRRDAI
PIFEETNVFDLINDLSYKLFCVLVDECQFLNKHHVIEFARIVDELDIPVMAFGLKNDFRN
ELFEGSKYLLLYADKLEELKTICWFCHKKATMNLHYIDGKPVYEGDQVQIGGNEAYYPVC
RKHYFHPKTVNEEQ
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctcaattatttttcaagtatggcgcaatgaacagtggtaaaaccattgaaatctta
aaagtagcacacaattacgaagaacaagacaaaccagttgttttgatgaccagtggacta
gatacacgtgatggtgttgggaaagtatccagtcgcatcggattacgcagagatgctatt
ccaatttttgaagaaaccaatgtttttgacttgattaatgatttgtcttacaaacttttt
tgcgtattagtcgatgaatgtcaatttttaaacaagcatcatgtcattgaatttgcacga
attgttgacgaattagatattccagtaatggcatttgggctaaagaatgattttagaaat
gaattatttgaaggctcaaagtatttacttttatatgcagacaaattagaagaattaaaa
acgatttgctggttctgtcataaaaaagcaactatgaacttgcactatattgatggcaaa
cccgtttatgaaggggatcaagtccaaattggtgggaatgaagcctactatcctgtttgt
cgcaaacattattttcatccaaaaacagtgaatgaagaacagtaa

DBGET integrated database retrieval system