KEGG   Enterococcus gallinarum: AL523_14870Help
Entry
AL523_14870       CDS       T04148                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ega  Enterococcus gallinarum
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ega00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AL523_14870
Enzymes [BR:ega01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AL523_14870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3174794..3176806)
Genome map
AA seq 670 aa AA seqDB search
MTKFFDRILFGGDYNPNQWPKEIWEEDIRIFKKASINSATVNVFSWAKIQPSENCYDFEE
LDQIIEKLSTEGFDIVLATSTAALPAWMFKKYPEVARTDYDGRHHKFGQRHNACPNSLVY
QKYAERLATKLAERYGENPQVTCWHINNEYGGECYCENCEKAFRVWLKDKYQTIEALNKA
WNMEFWGHTVYEWDEIVLPNALSEGIGYDKTAFAGISIDYRRFNSDSLLKNYMMERDAIR
KIDPTTPITTNLMGTFKGLDYFKWAKEMDLISWDNYPAYNTPWSLVAMTHDLMRGLKQQP
FMLMEQTPSQQNWQPYNSLKKPGQMRAQSYQTIAHGADTIQYFQLRRSIGACEKFHGAVI
EHVGHEDTRVFRETAALGAELAQLSDIIGTQTQAQVAVIFDWDNYWALEYTSGPTVDLKY
VEQIHRYYRYFHEQNIAVDLVPVDADLSKYKLVAAPVLYMIKEGMQERLTDFVKQGGSLL
TTYMSGIVDQSDNVHLGGYPGPLRELAGIWVEEIDALAPEQSNGVSLVNEELTGTSNLVS
DLIHLETAEALAHYTSNFYAGMPAVTKNMFGDGTVYYFGGQLEDQLQDQLFKTIVEENDI
TPVIEEATKLEVACRENAEAKFFVIINFHEEAQPLPAMFVGKTDLLTGEVLSSEMMLTQY
TTYIVKEERN
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaattttttgatcgaattctattcggcggcgattataatccaaatcagtggccg
aaagagatttgggaagaagacattcggatctttaaaaaagcaagtatcaatagcgcgacc
gtcaatgttttttcatgggcaaagatccaaccctctgaaaattgttatgattttgaggaa
ttggatcaaatcatcgaaaaattaagtacggagggcttcgacatcgtcttagccacttcc
acagccgctttgccagcttggatgtttaagaagtatccggaagtcgctcgcaccgattat
gatggacgccatcataagtttgggcaacggcataatgcctgtcccaatagtttggtttat
caaaaatacgcagaacgtctggcaacgaaattagccgaacgttacggcgaaaatccacaa
gtgacttgttggcacatcaataatgaatacggcggcgaatgttattgcgagaactgtgaa
aaagcgtttcgtgtttggctaaaggataaatatcaaacgatcgaagcactgaataaagcc
tggaatatggaattttggggtcatactgtatatgaatgggatgaaatcgttctgccaaat
gcgctgtcagaaggaatcggctatgacaagacggcatttgcaggaatttctattgactac
cgacgcttcaactcggatagccttttaaaaaactatatgatggagcgggacgctattcgg
aaaatcgatcccacgacaccgattacaacgaatttgatgggaacctttaaaggactggat
tatttcaagtgggcgaaggaaatggaccttatttcgtgggataattatccagcgtataat
acgccatggagtttagtagccatgacacatgatctaatgcgcggcttgaaacaacagccc
tttatgctgatggaacaaacaccctcccaacaaaactggcaaccctataactcattaaaa
aaaccgggacaaatgcgggcgcaaagctaccaaacgatcgctcatggggcggacacgatc
caatatttccaattgcgacgttccatcggtgcttgtgagaaattccatggagctgttatc
gaacatgtcggtcatgaagacacgcgagttttccgagaaacggcagctcttggtgctgaa
ttagcgcagctttcagacattattgggacgcaaactcaagcacaggttgccgtgattttc
gattgggacaattattgggcattagaatatacgagtggtccgaccgttgatctgaagtat
gtagaacagatccatcgctactatcgttattttcatgaacaaaatattgccgtcgacttg
gttcccgtggatgctgacttgtcaaaatacaaattagtcgcagcacctgttctctacatg
atcaaagaaggaatgcaagagcggctcactgatttcgtcaaacaaggtggttctttactt
accacgtatatgagcggtatcgttgatcaatctgacaacgttcacttagggggctatcct
gggccattgcgggagttagctggcatctgggtggaagaaatcgatgcattagccccagaa
caatcaaacggcgtttccttagtcaatgaagaactgacaggaaccagtaatttagtcagc
gatttgatccatttagaaaccgccgaagcgctagcgcattacacaagcaatttctatgca
ggaatgccggcagtgacgaaaaatatgtttggcgatggcaccgtctattactttggtgga
cagttggaagatcagctgcaagatcagcttttcaaaacgattgtcgaagaaaacgatatc
accccagtgatcgaggaagcaacaaaactagaagttgcctgtcgtgaaaatgcagaggcg
aaattcttcgttatcatcaatttccacgaagaagcacaaccgttgccagcaatgtttgtt
ggaaagacggatcttctgacgggtgaggttctttcttcagaaatgatgctgacacaatac
accacctatatcgtcaaagaggagcgtaactga

DBGET integrated database retrieval system