KEGG   Erwinia gerundensis: EM595_0298Help
Entry
EM595_0298        CDS       T04258                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ege  Erwinia gerundensis
Pathway
ege00564  Glycerophospholipid metabolism
ege01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ege00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    EM595_0298 (glpD)
Enzymes [BR:ege01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EM595_0298 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 3HCDH_N NAD_binding_8 Lycopene_cycl GIDA FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: CUU22535
UniProt: A0A0U5L209
LinkDB All DBs
Position
1:complement(346534..348042)
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRVGLFMYDHLGKRTSLPGS
KSLRFGADSALKPEITRGFEYSDCWVDDARLVVLNAQEVEKRGGEVRTRTRVTRAWREND
IWVVEAEEVDTGKTLTWRAKGLVNAAGPWVKQLFDDGLKLKSPYGIRLIKGSHIVVPRVH
TEKQAYILQNEDNRIVFVIPWMDEFSIIGTTDVEYKGDPKNVHIDDNEIDYVLNVFNAHF
KKDLSRKDIVWSYSGVRPLCDDESDSPQAITRDYTLDVRDENGKAPLLSVFGGKLTTYRK
LAEHAMEKMSKYYPGIGAAWTKNCVLPGGDFSGTREDYAAGLRRRYPFITENMARHFART
YGSRTEVILQNASSLDDLGENFGHDFYEVELRYLMENEWVRELDDAIWRRTKQGMWLNEA
QQARVSEWLAAHAKKPALSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacctgatcgtaatcggcggcggcatcaacggagccggcattgcagcc
gatgctgcaggacgcggactgtctgtgctgatgctggaagcgcaggatttggcctgcgca
acctcttccgccagttcaaaacttatccacggtggcctgcgctacctggaacattacgaa
ttccgtctggtcagcgaagcgctggctgaacgtgaagtgctgctgaaaatggcgccgcat
atcgctttccccatgcgcttccgcttgccgcaccgtccgcatctgcgtccggcgtggatg
atccgcgttggcctgtttatgtacgatcatcttggcaaacgtaccagcctgccgggcagt
aagagtttgcgttttggcgcggattccgctctcaagccagagatcacgcgcggtttcgaa
tactctgactgctgggtagatgatgctcgcctcgtggtgctcaatgcgcaggaagtggaa
aaacgcggtggcgaagtgcgcacccgtacccgtgtgacgcgcgcctggcgtgaaaatgac
atttgggtggttgaagctgaagaagtggataccggcaaaaccctgacctggcgtgcaaaa
ggtctggtcaacgccgctggcccatgggttaagcagctgtttgacgacggcctgaagctg
aaatcgccttatggtattcgcctgatcaaaggcagccatatcgtggtgccgcgcgtgcat
accgaaaaacaggcttatatcctgcagaacgaagacaatcgcattgtgtttgttattccg
tggatggatgagttttccattatcggtaccaccgacgtggagtacaaaggcgatccgaaa
aacgtccatatcgacgataacgagatcgattatgtgctgaacgtcttcaacgcgcacttc
aagaaagacttgtcgcgtaaagatatcgtctggagctattccggcgttcgtccgctgtgt
gacgacgaatccgattcgccgcaggccattacccgcgattacacgctggatgtgcgtgat
gaaaacggtaaagcgccgctgctgtcggtgtttggcggtaaactgaccacctatcgtaag
ctggctgagcatgcgatggagaagatgtccaaatactatccgggcattggtgcagcatgg
accaaaaactgcgtgctgccaggcggtgatttctcaggcacgcgtgaagattacgcggcc
ggtttgcgtcgccgttatccgttcattactgaaaatatggcgcgtcattttgcccgcacc
tacggtagccgtaccgaagtgattctgcagaacgccagctcgctggacgatctgggtgag
aacttcggccacgacttctacgaagtcgaactgcgttatctgatggaaaacgagtgggtt
cgcgaactggatgatgcgatctggcgccgtaccaaacagggtatgtggctgaatgaagcg
cagcaggcgcgcgtgagcgaatggctggcggcgcatgcgaagaagccggcgctctcgctg
gcaagctaa

DBGET integrated database retrieval system