KEGG   Elizabethkingia genomosp. 4: BBD34_18005Help
Entry
BBD34_18005       CDS       T05036                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ego  Elizabethkingia genomosp. 4
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ego00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBD34_18005
  Amino acid metabolism
   00310 Lysine degradation
    BBD34_18005
   00380 Tryptophan metabolism
    BBD34_18005
Enzymes [BR:ego01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BBD34_18005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3963752..3966559
Genome map
AA seq 935 aa AA seqDB search
MDRFSFLNAVHSQFIEDMYQQYLKYPDSLEPSWKAFFQGFDFALENYSDEEAVQEIKSFA
SQAENSNVNISEISEDIRREFKVINLIEAYRVRGHLFTKTNPVRERRHFEPTLDIENFGL
TSADLNRKFNSATETGMPGPATLSEIIRHLQSIYCDSIGVEYMYIKNVEERDFIRQWLQA
NENHAKLSPEEKKHVLQRLNQAVAFESYLHTKFVGQKRFSLEGLESLIPALDQVITKSSQ
LGVDEVVLGMAHRGRLNVLTNIFQKPYKQIFSEFEGKEFEEDVFSGDVKYHLGASKVIQT
TAGETVKINLTPNPSHLETVASLVEGISRAKVDNSYNGDYNKILPIVIHGDAAIAGQGIV
YEIAQMMTLDGYKTGGTIHIVTNNQVGFTTNYLDARSSTYCTDVAKVTDSPVMHINADDV
EAVVHAMHFAADFRNRFGKDVYIDLLGYRKYGHNEGDEPKFTQPKLYNIIAKHPNPREIY
KDKLIKEGIVSDDVMKQMEVEFKKLLDENFDESKEIKKNTMDIFMADDWKKFPFGSRGSV
LNPVDTKFPLDKLKDLARQISTLPTDKKFIKKITRLFEQRLNMVENDNLDWAMGELLAYA
TLLSEEFGIRISGEDVERGTFSHRHAVVKTEDTEEEYVPLKSVTTKDNQFQIYNSLLSEY
AVLGFDYGYAMVSPDTLTIWEAQFGDFANGAQIIIDQYLVAAEEKWKLQNGLVMLLPHGS
EGQGAEHSSARLERFLTLCANQNIIVANATTPANYFHLLRRQMKADFRKPLVVMTPKSLL
RHPRAVSKVEELANGAFQPIIDDATAKADKVERLVLCSGKLYYELLAKKEELNDEKVALV
RLEQLYPLQMDQLDAIFEKYSNAKEFIWAQEEPENMGAWSYILRNLRDRNPQVISPVASG
APAPGSHKKFEINQNAIINQVFQCDGTPAKRPVTA
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atggacagattttcattcttaaatgcggtacattctcagtttatagaggatatgtaccag
cagtatttgaaatatcctgacagtctcgaaccatcatggaaagctttttttcaggggttt
gatttcgctttggaaaactacagtgatgaagaagcagtacaagaaattaaatcttttgca
tcacaggcagagaacagcaatgtcaatatttcagaaatttccgaagacattcgcagagaa
ttcaaagtaattaatcttatcgaggcataccgtgttcgtggtcaccttttcactaaaacc
aatccggttagagagagaagacacttcgagccaaccttggatattgaaaattttggactg
acttctgctgatttaaatagaaaattcaacagcgctacagaaaccggaatgccgggacct
gcaacgcttagtgaaataataagacatcttcagagtatctactgcgattctatcggagta
gaatacatgtacattaaaaatgttgaagaaagagatttcattcgtcagtggcttcaggca
aatgaaaaccacgcaaaactttctcctgaagagaaaaagcatgttttacagagacttaat
caggcagtagcttttgagagctacctgcatacaaaattcgtaggacagaagcgtttctca
ttagaaggtttggaatctttaatccctgcgttggatcaggttattactaagtcttcacaa
ttaggtgttgatgaagtagtattgggtatggcacacagaggaagactgaatgtgttaaca
aacattttccaaaagccttacaagcaaattttcagtgaattcgaaggtaaagaatttgaa
gaagatgtattctctggtgacgttaaatatcacttaggagcatctaaagttattcagaca
actgccggagaaactgtaaaaattaatcttacaccgaatccgtctcacctggaaacagtt
gcttcattagtagaaggtatcagccgtgctaaagtagacaacagctacaacggagattat
aataagattttaccaatcgttattcatggtgacgctgcaattgccggacagggaattgta
tacgaaattgcacagatgatgacgctggacggatataaaacaggaggtacaatccacatc
gttacaaataaccaggtaggatttacaaccaattatttagatgcacgttcatctacttac
tgtacagatgtagcgaaagtaactgattctccggtaatgcatattaatgcagacgatgta
gaagcagttgttcacgcaatgcattttgctgcagacttccgtaacagatttggtaaagat
gtttatattgatcttttaggatatagaaaatatggccacaacgaaggtgatgaacctaag
tttacacagcctaaattatacaacatcattgcaaaacaccctaaccctagagaaatttat
aaagataaattaatcaaggaaggtattgtttctgacgacgtgatgaagcaaatggaagtt
gaattcaaaaaattattggatgaaaacttcgacgaatctaaagaaattaagaagaatacc
atggatatcttcatggcagacgattggaagaaattcccgtttggatccagaggatcagtt
cttaatcctgtagatactaaattcccattagataaacttaaagatttagcaagacagatt
tctacactgcctacagataagaaatttatcaaaaaaatcacaagattattcgagcagaga
cttaatatggttgagaacgataatcttgactgggcaatgggtgagcttttagcttatgct
acattgctaagtgaagagtttggtatcagaatttctggtgaagatgtagaaagaggtact
ttctctcaccgtcatgcagttgtaaaaactgaagatacagaggaagaatatgtaccatta
aaatctgttactactaaagataaccagttccagatctataactcattactttctgagtat
gcagttttaggattcgattacggatatgcaatggtgtctccggatacccttacaatctgg
gaagctcagtttggtgatttcgctaacggagcacagattattatcgaccagtatcttgta
gcagctgaggaaaaatggaaactgcaaaacggattggtaatgttattgcctcatggttct
gaaggacaaggtgctgaacactcttctgcaagattagagcgtttccttacactttgtgca
aaccagaatattattgtcgctaatgctacaacaccagctaactacttccacttgttgaga
aggcaaatgaaagctgatttcagaaaaccattagtagtaatgactccaaaatcattattg
cgtcatccaagagctgtttctaaagttgaagaattggcaaacggagcattccagccaata
attgatgatgctacagctaaggctgataaagtagaaagattagtattatgttcaggtaaa
ttgtattatgaactattagctaaaaaagaagaactgaatgatgagaaagttgctttggta
agactagagcagttatatcctcttcaaatggatcagttggatgctattttcgaaaagtat
tctaatgctaaagaattcatctgggcacaggaagagcctgaaaacatgggcgcatggagc
tatatcctgagaaacctaagagacagaaatcctcaggtaatttccccggtagcaagtggg
gcacctgcaccgggttctcataagaaattcgagatcaaccagaatgcaattatcaatcag
gtatttcagtgtgatggaacacctgcaaaaagaccagtaacagcttaa

DBGET integrated database retrieval system