KEGG   Elizabethkingia genomosp. 4: BBD34_18215Help
Entry
BBD34_18215       CDS       T05036                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ego  Elizabethkingia genomosp. 4
Pathway
ego00620  Pyruvate metabolism
ego00680  Methane metabolism
ego01100  Metabolic pathways
ego01120  Microbial metabolism in diverse environments
ego01200  Carbon metabolism
Module
ego_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ego00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBD34_18215
  Energy metabolism
   00680 Methane metabolism
    BBD34_18215
Enzymes [BR:ego01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BBD34_18215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AQX10446
UniProt: A0A1T3FS45
LinkDB All DBs
Position
4014994..4017531
Genome map
AA seq 845 aa AA seqDB search
MKTNEQVEKFRQIVKNKFQIYNSLFMSLPYDKMTNIGMLLPFLHEESKEGYENGKSPMEV
MKHFFDSHTDLKTEEERIDLLFRIIQYVERQVVLFDSIEDSAFSTLNANTDPGTVRNLYE
VASQQGKLQIIKEKMEQFGVKVVFTAHPTQFYSNSVQSILHDLNQAIKSDSVTNIDMLLQ
QLGMTSFINQEKPTPYDEAQSIIYYLRYVYYDTLGELYRDTKRIFDDANINPHLFQLGFW
PGGDRDGNPFVTAEITQRVSSELRLAILKCYYEHLKKLRKRITFPKVTEMLRQISERVYQ
NIFENKYDLTAEEFKKALEDIRYEVKENNNGLFIDKIDDLIGRIDLFGIYFASLDIRQNS
KIHYKALEQIFEKEFGKDYHALNEDEKLNLLLNTSLQVDPENYSDDIVKDTLKNIYQVKD
IQKLNGEQSIHRYIISDSSSIYDVLNVYALFKYCGYADKDIKIDIVPLFETIEGFENAEA
TMNKLYNLTQYKEHLNRRSGRQFIMLGFSDGTKDAGYIKANWDIYTTKEVLSKVSDENDI
KVIFFDGRGGPPARGGGKTHQFYAAQGKSIANHQIELTIQGQTITSVFGTKDQATFNFEQ
LLTAGLENEIFPQDKINLKDWERNLLNELAGISYQKYKALKDHPLFVPYLEEVSTLKYYG
RTNIGSRPSKRNDGQLVFEDLRAIPFVGSWSLLKQNVPGYFGVGTALQRLKEEGKLEDLK
KLYRESMFFKTLIQNSMMSMSKTYFPLTYYLRNDKVFGEFWQILHNEYLLTNEMLLEIAD
YKALMEEEPLSKSSIKMRENIVLPLLTIQQYALQKIKEENPHKETYEKIITRALFGNINA
SRNSA
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccaatgaacaagtagaaaaattcagacaaattgtaaaaaacaaatttcagatc
tataatagccttttcatgagccttccatatgataaaatgacgaatatcggaatgctcttg
ccttttctccatgaagagagcaaagaaggctatgaaaatggaaaatctccgatggaggtg
atgaaacatttcttcgacagtcatacagacctgaaaacagaagaagaacgaatagatctt
ctgttccgtattattcagtatgtagaaagacaagtagtattattcgacagtatcgaggat
tcagcattttctacactaaatgccaatacagatccagggacagtccgtaatttgtatgaa
gttgcatcccaacaaggaaaactgcaaattattaaagagaaaatggaacaattcggtgtt
aaggttgtgtttacagcacacccgacacagttttattccaattctgtgcaatctattctc
catgatctgaatcaggctataaaatccgattcagttaccaatatagatatgctcctgcag
cagttggggatgacgtcatttatcaatcaggaaaagccaaccccatatgacgaggctcag
agtattatttattatctgcgctatgtttattatgatactctgggagaactgtatcgggat
accaaacgcatttttgatgatgctaatataaatccgcatttattccaattaggcttttgg
ccgggaggagacagagatggtaacccttttgtaactgcagaaattactcagcgagtatct
tccgagttgagactggctattcttaaatgctattatgagcaccttaaaaagctccgaaaa
agaattactttccctaaggtcaccgaaatgctgagacaaattagtgaaagagtatatcag
aatatttttgagaataaatatgatcttactgctgaagagtttaaaaaagctttagaggat
atccgctatgaagttaaagagaataacaacggattgtttattgataaaatcgacgatctt
ataggccgtatagatctatttggaatctatttcgcttcgctggatattcgccagaacagt
aaaatccattacaaagcgctggaacagatttttgaaaaagagtttggtaaagattaccat
gcattgaatgaagacgaaaaattgaatctacttctcaacacttccttacaggttgatcct
gaaaattatagtgatgatatagtaaaggatacattaaaaaatatctatcaggtaaaagat
attcagaaactaaatggagagcaaagtattcaccgttatattatttcggacagttcctct
atttatgatgttctgaatgtttatgccctatttaaatattgtggttatgccgataaggat
ataaaaatagatattgttcccttgttcgaaaccatagaaggctttgaaaacgctgaggca
acgatgaacaagctttataaccttactcagtataaagaacatttgaatcgccgtagtggc
agacaatttattatgcttggattttcagacggaacaaaagacgctgggtatataaaagca
aactgggatatttatactaccaaagaagtactgtcaaaagtttcagatgaaaatgatatc
aaagtaatattctttgatggtagaggtggaccacctgcacgtggtggtgggaaaacacac
cagttttatgcggcacaagggaaaagtattgccaatcaccaaatagaattgacaattcag
gggcaaacaattaccagtgtctttggaacgaaagatcaggcaacctttaactttgagcag
ttacttacagcaggattggaaaacgaaattttccctcaggacaaaataaatctgaaagat
tgggaaagaaatttactaaatgagcttgccggaattagctatcagaaatataaagcactt
aaagatcatcctcttttcgtgccttacctggaagaggttagtacactgaaatattatgga
cgtaccaatatcggaagccgtccgagtaagagaaatgacggacaactggtattcgaagat
ctaagagcaatcccgtttgtaggatcatggagcttattgaagcaaaatgtacctgggtac
ttcggagtgggtacggctttacaaagattaaaagaagagggcaaactggaagatttgaaa
aaactatacagagaatctatgttctttaagacacttattcagaatagtatgatgtctatg
agtaagacttactttccgctgacctattatttgcgtaatgacaaagtgtttggtgaattt
tggcagattctgcacaatgaatacctgctgactaatgaaatgctgttggaaattgcagat
tacaaagctctgatggaagaagaaccattgtctaaaagctccatcaaaatgagagaaaat
attgtattgccattgctaaccattcagcaatatgccttacaaaaaattaaagaagagaat
ccgcataaggaaacctatgaaaagattataacaagggcattattcggaaatattaatgca
agccgtaattcggcataa

DBGET integrated database retrieval system