KEGG   Eucalyptus grandis (rose gum): 104433278Help
Entry
104433278         CDS       T03547                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain 3B, chloroplastic
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:egr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    104433278
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    104433278
Enzymes [BR:egr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     104433278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 179 aa AA seqDB search
MASASMLSSPAVRATPAQATMVAPFTGLKSASAFPVTRKSSEDITSLSSNGGRVQCMQVW
PPIGKKKFETLSYLPPLSPESLAKEVDYLLRSGWVPCLEFELEHGFVYREHHSSPGYYDG
RYWTMWKLPMFGCTDSAQVLKELEEAKKAYPTAFIRIIGFDNKRQVQCISFIAYKPPGF
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcctcagcctcaatgctctcgtctccagccgtccgggctaccccggctcaggccacc
atggtcgccccattcaccggcctcaagtccgcctcggctttcccggtcacccgcaagtcg
agcgaggacatcacctctctttccagcaatggcggaagagtccaatgcatgcaggtgtgg
cctccgattggcaagaagaagttcgagacgctgtcctacctccctcccctctctcccgag
tccttggccaaggaagtcgactaccttcttcgcagcggatgggttccctgcctcgaattc
gagctcgagcacgggttcgtgtaccgcgagcaccacagctcccccgggtactacgacggg
cgctactggacaatgtggaagctccccatgttcgggtgcaccgactcggcccaggtgttg
aaagagctggaggaggccaagaaggcttatcccacggcgttcatccggatcatcgggttc
gacaacaagcgccaagtgcagtgcatcagcttcatcgcctacaagccccccggcttctaa

DBGET integrated database retrieval system