KEGG   Eucalyptus grandis (rose gum): 104438216Help
Entry
104438216         CDS       T03547                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:egr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104438216
   00051 Fructose and mannose metabolism
    104438216
   00052 Galactose metabolism
    104438216
   00500 Starch and sucrose metabolism
    104438216
   00520 Amino sugar and nucleotide sugar metabolism
    104438216
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    104438216
Enzymes [BR:egr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     104438216
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 500 aa AA seqDB search
MGKKVAVVLCVAAAAVVAAGAAVVVRRQMKRSGKWARAMAILKEFEDKCGTPIGKLRQVA
DAMTVEMHAGLASEGGSKLKMLISYVDNLPTGNEQGLFYALDLGGTNFRVLRVQLGGKEK
GVVSQEFEEVSIPPYLMIGSSEALFNYIAEALAKFVATESEGSHPYPGRQRELGFTFSFP
VRQVSISSGTLIKWTKGFSIEDAVGEDVVGELTKAMEKIGLHMRVTALVNDTIGTLAGGR
FYNSDVIAAVILGTGTNAAYVERAQAIPKWHGPLPKSGEMVINMEWGNFRSSHLPLTEYD
QALDSESLNPGEQIFEKTISGMYLGEVVRRVLLKMAEEASFFGDNVPPKLRISFILRTPD
MSAMHHDTSSDLKVVGNKLRDILEISNTTLKMRKVVVELCDIVATRGARLSAAGIVGILK
KLGRDSAKEGAEQQKSVIALDGGLFEHYKKFSACMESTLKELIGEEVAQNIVIEHSNDGS
GIGAALLAASHSEYLMAEEP
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaaggtggcggtggtgctgtgcgtggcggcggcggcggtggtggcggcgggg
gcggcggtcgtcgtgaggaggcagatgaagagatccgggaaatgggccagggccatggcc
atactgaaggagtttgaggacaagtgtgggaccccaatcgggaagctccgccaggtggcg
gacgccatgaccgtcgagatgcacgccgggctcgcatccgagggcgggagtaagctcaag
atgctcatcagctacgtggacaatctccccactgggaatgagcaaggattgttttatgca
ttggacctgggtggtacaaatttccgggtccttcgtgttcagttgggaggaaaggaaaag
ggtgttgtttcccaagaatttgaggaagtttcaatacctccttacttaatgattggatct
tcagaagctttgtttaattacattgctgaggcacttgcgaagtttgttgccacagaaagt
gaaggttctcatccttaccctggtaggcaaagggagctaggctttaccttctccttcccc
gttaggcaagtatctatatcgtcagggacattaatcaaatggacaaagggcttttccata
gaagatgcggttggggaggacgttgtgggtgaactgaccaaagcaatggaaaaaattggc
ctccacatgcgtgtaacagctttggttaatgacacaatcggaacattagctgggggcaga
ttctacaattccgatgtaattgctgctgtcattttgggtaccggaacaaatgcagcttat
gttgaaagggctcaggcaattcctaagtggcatggtcctctgcctaaatcaggagaaatg
gtcattaacatggaatggggcaacttcaggtcgtcacaccttcccctgacagagtatgat
caggcactggatagtgaaagtcttaacccaggagagcagatttttgagaagacaatatca
ggcatgtacttgggagaagttgtgcgtagagttttactgaaaatggctgaagaagcttca
tttttcggtgacaatgttcctcctaaattaagaatctctttcatattaaggacaccggac
atgtctgctatgcatcatgacacgtcttccgatcttaaagttgttgggaacaaactgagg
gatatcttagagatatccaatactaccttgaagatgagaaaagtggttgttgagctctgt
gacattgtcgccactcgtggagctcgcctatctgctgctgggatagttgggatcctgaaa
aaactgggaagagacagcgcaaaagagggagcagaacagcagaagtcagtaattgcactt
gacggtggtttgttcgagcactacaaaaaattcagtgcctgcatggagagcactctaaaa
gagttgattggagaggaagtcgcgcagaacattgttattgagcactcaaatgacgggtct
ggcataggagctgcccttttagcagcttcgcactccgaatatctcatggctgaggagcct
tga

DBGET integrated database retrieval system