KEGG   Eucalyptus grandis (rose gum): 104457220Help
Entry
104457220         CDS       T03547                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SUVR5
Organism
egr  Eucalyptus grandis (rose gum)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1515 aa AA seqDB search
MEWLSRTKQYAGKTDCSQQISETNAVHDGESVHLESEKRVQTSDSRVDTVFFTVDGKGND
VQVDGEEAVHHTRDLEDQLGGASHSDCSMDDPKASSGSLDFEESNINEQTYCTESLLASE
NSQIIVDTIESELPSNNRDGESSVSEPKWLEGDESLALWVKWRGKWQAGIKCERADWPLS
TLKAKPTHERKKYFVIFFPHTRNYSWADMLLVRPIYEFPEPIAHRTHKAGIKTVKDLTVA
RRFIMRKLAVGMLNIVDQLHLQALIEAARDVLVWKEFATEASHCTGYTDLGRMLLKLHTM
ILQRYISSEWLQQAFTSWEQRCQKADSAETIELLTEELFDSVLWKEVNSLEAPMQPLLNS
QWRTWKHDVTKLFSTSHPEFTGANIDSRENGDPIVPNLQMNRKRPKLEVRRADVHTSQIE
SKGSDEAATVEIDSEFFNSRDTVNGSALMSEPRQHEPPGIGGEAMASPGSVAEWDKIVVE
GKHGDSIQANNIGLNLAKPVETTPVNETVSKKALFTGGKSRQCVAFIESKGRQCVRSANE
GDVYCCVHLASRFLGSSARAERTPPAETPPCQGTTVLGTKCKHRSLPGSTFCKKHRPQTD
HTKSSVVSENSHKRKHEESIWRSENVHSKGVEAGRVQSLVRADPVTVSLSTVKGFGEMPE
HSGRNLNGMEVAPHCIGLLSPDKTEQCMDNPSRYSLYCDKHLPSWLKRARNGKSRIISKE
VFLELLEDCSSEEQKIHLHQACELFFRLFKSILSLRNPVPMEVQLQWALSEASKDLRVGE
FLMKLVCSEKERLTRIWGCGATEDGQDILPEMEEEAMLPLTDDGSNNDEKVIKCKICSEE
FVSDQVLGSHWMDRHKKEAQWLFRGYACAICLDSYTNKKVLETHVQERHHVQFVEQCKLL
QCIPCGSHFGNVEELWSHVLSVHPSEFRSSKVARKPNPSAVEDLPLKPEPANLAPIDNNT
VKASGVRKFVCRFCGLKFNLLPDLGRHHQAAHMGPSLASSRPSKKGVRYYAYQMKSGRLS
RPRFKKALGAASYRIRNRASLKKRIQASKSLSSMVTNLQPHVTEVARYTRLAESECSRIA
QVLFSHIQKTKCRPSNLDVLSIARSACCKYSIKASFEQMYGVLPERFYLKAAKLCSENNI
HVSWHLDDFVCPNGCKPEEDPRVLSPLIPLSKGNVDHSSQHLAEHLDDEWEVDESHYVID
SQQLKSRTPQNAIVLCEDISFGRESVPIACVVDEWLLDSLDVVGAEGQNAICSMPWESFT
YVTKPVVDQSAAFETESLQFGCTCKNFSCRQEACDHVYLFDNDNEDAKDIYGRSMHGRFP
YDEFGRIILEESYLVYECNRMCHCSKTCHNRVLQRGVRLKLEVFRTEKKGWAVRAGEAIS
RGTFVCEHIGEVLDDLEADNRRKRYDGKEGGSYLFDINSHFKDMSRLTEEEVKYVIDATK
YGNVSRFINHSCSPNLLNHRVLVESMESHRAHIGFYASRDIASGEELTYDYHYEVLPGEG
APCHCEASNCRGRLY
NT seq 4548 nt NT seq  +upstreamnt  +downstreamnt
atggagtggctctctcgtacaaaacaatatgctggaaaaacagattgctcccaacagatt
tcagagacaaatgctgtccatgatggagaatctgtacaccttgaatctgagaaacgagtt
caaacttcagatagcagagtagatactgtattctttactgtggatgggaaaggaaatgat
gtacaagttgatggtgaagaagcagtccaccatacacgtgatcttgaggaccagttgggt
ggagcttcacattctgattgctcaatggatgacccaaaagcatctagtggttctcttgat
tttgaagaaagtaacataaatgaacagacctattgcaccgaatctttattggcatctgag
aattctcaaataatcgtggatactattgaaagtgaactgccaagcaataacagggatgga
gaatcatcagtttctgagcctaagtggctagagggagatgaatctttagcattatgggtg
aagtggagaggtaagtggcaggcagggataaaatgcgaaagggctgactggccattatca
actttgaaagcaaagccaactcatgagaggaagaagtactttgtcatatttttcccacac
acaagaaattattcatgggcagatatgcttctcgttcgtcctatttatgaatttccagag
cccattgctcataggacacataaagctggaataaaaacagtcaaagatttgacagttgca
cgccgttttataatgcggaagctagctgttggcatgttaaatattgtcgatcagttgcac
ctacaggccttgatagaggctgcaagggatgtacttgtctggaaggagtttgctacggaa
gcatctcattgcactggctataccgatcttggaaggatgctcttgaagctgcacactatg
atattgcagcgctacataagttctgaatggctacagcaagcatttactagttgggaacag
aggtgtcagaaggcagacagcgctgaaactattgaattgttgacggaggaattgtttgat
tctgtcttgtggaaggaggtaaactccttggaggctccaatgcagcccctgctgaattct
cagtggagaacctggaagcatgatgttacgaaactgttctcaacgtctcatcctgaattt
actggtgcaaacattgacagccgagagaatggtgatcccatagtccccaatctccagatg
aataggaagaggcccaaacttgaagttcgtcgtgcagatgtgcatacttctcagatagaa
agcaaaggatctgatgaggctgcaactgtcgagattgattctgaatttttcaactctcga
gacactgtaaatggttctgctttaatgtctgaacctcgtcagcatgaacctccaggtata
ggtggcgaagcgatggcttcaccaggtagtgtggctgaatgggacaaaattgttgtggag
ggaaaacatggtgactcaatccaagccaacaatattggattgaatcttgcaaaacctgtg
gaaacgacacctgtaaacgaaacggtcagtaaaaaggccttatttactggtggtaagagt
cggcagtgtgtagcttttattgaatccaaaggaaggcaatgcgttaggtcagccaacgaa
ggtgatgtttactgctgtgtgcatttggcctctcggtttttgggaagttccgctagagca
gaaaggacgcctcctgctgaaacaccgccctgtcaaggtaccacagtattaggcacaaaa
tgcaagcaccgttctcttccgggctccacattctgtaagaagcacaggcctcaaactgac
catactaaaagctcagttgtgtcagaaaattcacacaagagaaagcatgaagagagtatc
tggaggtcagaaaatgtgcattctaaaggtgtggaagcagggagagttcaaagtctggtc
cgagctgatcctgtcacagtttcactgtcaacagttaaaggctttggtgagatgccagag
cattctggtagaaatttaaatggcatggaggtggccccccactgtattggcttgttatcg
cctgataagactgagcaatgcatggataatccaagtcgttattcgttgtactgtgacaag
caccttccgagctggcttaaacgagcgaggaatggtaagagtaggataatttcaaaagaa
gtgtttttagagcttttagaagattgctcctctgaggaacaaaagatccatttacatcag
gcgtgtgagctattctttaggctgtttaaaagcattttgtctcttcggaacccagttccc
atggaagtgcagctccagtgggccctatctgaagcttccaaagatcttcgtgtcggggaa
tttctcatgaagttggtctgctctgaaaaagaaagactaacgagaatttggggctgcggt
gccactgaagatggacaagatattctgccggaaatggaagaagaggctatgttaccgttg
acagatgatggtagcaacaacgacgaaaaggtgatcaagtgcaagatttgctcggaagaa
tttgtcagtgatcaagtccttggtagccattggatggacagacataagaaggaagcacag
tggctgtttagaggctatgcttgtgccatttgccttgattcttataccaacaagaaggtt
ttagaaacacatgtgcaggagagacaccatgtgcaatttgtggagcagtgcaaacttctt
cagtgtattccttgtggaagccattttggaaacgtggaagagctatggtcacatgttctc
tctgttcacccttcagaattcagatcgtcaaaggttgctcgaaaacctaatccctcagca
gtggaggatttacctttgaaacctgagcctgcaaacttagcccctatagacaataacact
gtaaaagcaagtggtgtgcgaaagttcgtttgcaggttctgcgggttaaaatttaatttg
cttccagatctcggccgtcatcatcaagctgctcatatggggccaagtttagccagttct
cggccttcaaagaaaggtgtacgttactatgcttatcagatgaaatcggggagacttagt
cgcccaagatttaaaaaagctttgggtgcggcatcttataggatcagaaatagggctagc
ttgaaaaagcgtatccaggcgtcgaaatcacttagctccatggtaacaaatttgcagcct
catgtgacagaagtagccagatataccaggttggcagaatctgaatgctcaagaattgca
caagtgctgttctctcatattcagaaaactaaatgtcggccaagcaatttggatgtttta
tctattgctcgctctgcttgctgcaaatacagcattaaagcctcatttgaacagatgtat
ggagtattgcctgaacgcttttacttgaaggcagccaaactatgcagtgagaacaatatt
cacgttagctggcacttagatgattttgtttgtcctaatggatgtaaaccagaggaagat
ccccgtgtgttgtctccattgatccctctttcaaagggtaatgtcgatcatagttctcaa
catttagcagagcatctggatgacgagtgggaagtggatgagagccactatgtcattgac
tcgcaacagttaaaatctaggacaccgcaaaatgccattgtcttgtgtgaagacataagc
tttgggcgtgaatcagttccaatagcttgtgtggtggatgaatggcttttggattctctt
gatgttgttggagctgaaggccaaaatgccatatgttccatgccttgggagagctttact
tatgttacgaagccagtagttgaccaatctgctgcctttgaaacagagagtttgcaattt
gggtgtacttgcaagaatttttcatgcagacaagaagcatgtgatcatgtataccttttt
gataatgacaatgaagatgcaaaagacatttatggaaggtccatgcatggaagattcccc
tatgatgagtttggtcgcatcatactggaggagagctaccttgtatatgagtgcaatcgc
atgtgccactgcagcaagacttgtcacaatagagttttgcagagaggagttcggctaaaa
ttggaagtcttcagaacagagaaaaagggttgggcagtccgggcaggtgaagcaatctcg
cgaggcacatttgtatgcgagcatattggggaagttttagacgacttagaggcggataat
cggcggaagaggtatgatggcaaagaaggtggcagttatctctttgacattaattcccat
tttaaggatatgagcagattaaccgaagaagaggtcaagtatgtgattgatgcaacgaag
tatggaaatgtttctcgcttcataaatcacagctgttcgcctaatctattgaatcatcga
gttctcgtggaaagcatggaaagccatcgtgcacatatcgggttttatgcaagccgagac
atagcttcaggtgaggaattaacctacgactatcattatgaagttcttcctggagagggt
gctccttgccactgtgaagcatccaactgccgcggccgtctatactga

DBGET integrated database retrieval system