KEGG   Elaeis guineensis (African oil palm): 105048437Help
Entry
105048437         CDS       T03921                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00630  Glyoxylate and dicarboxylate metabolism
egu00710  Carbon fixation in photosynthetic organisms
egu01100  Metabolic pathways
egu01200  Carbon metabolism
Module
egu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
egu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
egu_M00532  Photorespiration
egu_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:egu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    105048437
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    105048437
Enzymes [BR:egu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     105048437
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 105048437
NCBI-ProteinID: XP_010926041
LinkDB All DBs
Position
7
AA seq 180 aa AA seqDB search
MASSMTLSSAATASRATPAQSSMVAPFTGLKSTSAFPVTRRASNDFSKLPSNGGRVRCMQ
VWPIEGKKKFETLSYLPPLSIEALLKQIEYLLRSGWIPCLEFCKVGFVYRENHQSPGYYD
GRYWTMWKLPMFGCNDAAQVAKELDECKKEYPDVFIRIIGFDNVRQVQCISFIAYKPPGF
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctccatgacgctctcttctgcagccactgcttcccgggccaccccagcccaa
tccagcatggttgcaccctttaccggcctcaagtcgacttcggccttcccagttaccagg
agggcaagcaacgatttctccaagcttccgagcaacggaggcagggttcggtgcatgcag
gtttggccgatagagggtaagaagaagttcgagaccctctcttaccttccgccgctctcc
atcgaggctttgctcaagcaaattgagtaccttctccgcagtggatggattccttgcttg
gagttctgcaaagttggctttgtgtaccgtgagaaccaccaatcccctgggtactacgat
ggtcgctactggaccatgtggaaattgcccatgttcggctgcaatgatgcagcccaggtg
gcgaaggagctcgacgaatgcaagaaggaatacccggatgtgttcatccggatcatcggg
ttcgacaacgttcgccaagtgcagtgcatcagtttcatcgcctacaagcccccaggcttc
taa

DBGET integrated database retrieval system