KEGG   Elaeis guineensis (African oil palm): 105051780Help
Entry
105051780         CDS       T03921                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 5 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:egu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105051780
   00020 Citrate cycle (TCA cycle)
    105051780
   00620 Pyruvate metabolism
    105051780
Enzymes [BR:egu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     105051780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
9
AA seq 486 aa AA seqDB search
MASLASIHLGTPFLPSPASLRGRSAAGGGGGRGAAPRRAPRIQAKIREIFMPALSSTMTE
GKIVSWAKAEGDKLAKGESVVVVESDKADMDVETFYDGYLAAIMVEEGAVAAVGSAIALL
AETEDEIPLARSQAASSSATAASDGSTAAPPAAETPSPXPLETAPEALSSSPPPNFSPEA
ASSAHPASEGGRRTIATPYAKKLAKDLKVELGLVAGSGPMGRIVAKDVEAAAAVAAAAPV
STAPPKSVSTSSTVKAPASPAIQLGTVVPFTTMQGAVSKNMVESLSVPTFRVGYTITTNA
LDDLYKKIKSKGVTMSVLLAKATAMALMKHPVVNSSCRDGNSFTYNSSINIAVAVAIDGG
LITPVLQDADKVDIYSLSRKWKELVDKARAKQLQPHEYNTGTFTLSNLGMFGVDRFDAIL
PPGTGAIMAVGASQPTVVATKDGRIGLKSQMQVNVTADHQVIYGADLAAFLQTLAKIIED
PKELTL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcctcgccagcatccatctcggcacccccttccttccctccccagcctccctc
cgtggccgctccgccgccggtggcggaggcggcagaggagcagccccaaggcgggccccg
aggatccaggccaagatccgcgagatcttcatgccggcgctgagctcgacgatgaccgag
ggaaagatcgtgtcttgggcgaaggccgagggcgacaagctcgccaagggagagagcgtc
gtcgtcgtcgagtccgacaaggccgacatggacgtcgaaaccttctatgatggatatctc
gccgccatcatggtcgaggagggcgccgtcgccgccgtcggctccgccatcgctctcctc
gccgagaccgaggacgagatccccctcgccagatcccaagccgcctcctcctccgctaca
gcggcctccgacggctccaccgccgctcctccggctgccgaaaccccatctcctnctcct
ctggagaccgccccagaagccttatcctcttctcctcctccaaatttctctcctgaggct
gcttcttcggcccatccggcctctgagggcgggcgaaggaccatcgccacgccctacgcc
aagaagcttgccaaggatctgaaggtggagctgggattggttgctggaagcgggcctatg
ggaagaattgtggccaaggatgtggaagctgccgcagcggtggcggccgcagctccagta
tcaaccgctccacccaaatccgtctcaacttcttctacagtgaaggctccggcttctcca
gccattcaattgggtactgttgttccattcaccacaatgcagggtgctgtgagcaagaac
atggtggagagcctctcagtgccgacattccgggttggttataccatcaccaccaatgca
cttgatgacctctacaagaaaataaagtcgaaaggggtgacgatgtctgtgttgttggca
aaggcaactgctatggcattgatgaagcacccggttgttaattcaagttgtagagatggt
aatagctttacgtacaacagcagcatcaacattgccgttgctgtggctatagatggaggg
ttgatcactccagttctgcaggatgctgacaaggttgacatttattcattgtcaaggaaa
tggaaggagttggtagataaggcccgagctaagcagctgcaacctcatgagtacaacaca
ggtacatttactctatcaaaccttggaatgtttggtgttgaccgttttgatgcaattttg
cctcctggaactggagcaatcatggctgttggtgcatcccagccaactgttgttgctacc
aaggatgggagaattggtttgaagagccagatgcaggtgaatgttactgcagatcaccag
gttatttatggagcggatcttgctgcctttctgcaaaccttggccaaaattattgaggat
cccaaagaactcacactgtaa

DBGET integrated database retrieval system