KEGG   Elaeis guineensis (African oil palm): 105057287Help
Entry
105057287         CDS       T03921                                 

Definition
(RefSeq) glutathione transferase GST 23-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:egu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    105057287
Enzymes [BR:egu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     105057287
Transporters [BR:egu02000]
 Other Transporters
  Pores ion channels [TC:1]
   105057287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-GeneID: 105057287
NCBI-ProteinID: XP_010938160
LinkDB All DBs
Position
14
AA seq 225 aa AA seqDB search
MASGGEVKLFGMWASPAVRRVEWALKLKGIEYEYIEEDISNKSKDLVKYNPINKQVPVLL
HNGKPIIESLVIIEYIDEVWKHNPILPKDPYERAMARFWATYSEDKCRGAVREVFFAEGE
KRVKAIKCLEETLRALDEELKGKKFFGGENIGFSDLVLGWMAFWLGVSEEVASFEVLDPK
KFPWFTSWIDNFLKVPVIKENLPPRDKTVEFFHSYRRLHLAAPKC
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtggtggggaggtgaaactctttggaatgtgggcgagtcctgcagttcgtcga
gtcgaatgggccttgaagctgaaggggatcgagtatgagtacatcgaagaagacatctcg
aacaagagcaaagatcttgtcaagtataatccaatcaacaagcaagtccctgtgctcctc
cataatggaaagccgatcatcgaatcgcttgtcatcatcgaatatattgatgaggtttgg
aagcataaccccatcttaccaaaggatccttatgaacgtgccatggcacgcttctgggcc
acatatagtgaagacaagtgtcggggcgcagtgagagaagtcttctttgcagaaggagag
aagcgtgtgaaagctatcaaatgtttggaggagactctgagagcacttgatgaggagctt
aaggggaagaagttctttggcggagagaatattggattctcggacttggttttggggtgg
atggccttctggttaggggtgtcagaggaggttgcttcctttgaggtgttggatcctaag
aagttcccatggtttacttcatggattgataacttcctcaaagttcctgtgatcaaagag
aaccttccacctcgtgacaagacggtagagttttttcacagctatcgccggcttcacttg
gctgcaccaaaatgttag

DBGET integrated database retrieval system