KEGG   Elaeis guineensis (African oil palm): 105060442Help
Entry
105060442         CDS       T03921                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu03030  DNA replication
egu03410  Base excision repair
egu03420  Nucleotide excision repair
egu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:egu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    105060442
   03410 Base excision repair
    105060442
   03420 Nucleotide excision repair
    105060442
   03430 Mismatch repair
    105060442
Enzymes [BR:egu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     105060442
    6.5.1.6  DNA ligase (ATP or NAD+)
     105060442
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     105060442
DNA replication proteins [BR:egu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    105060442
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     105060442
DNA repair and recombination proteins [BR:egu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     105060442
   NER (nucleotide excision repair)
    Other NER factors
     105060442
   MMR (mismatch exicision repair)
    Other MMR factors
     105060442
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase UL42
Motif
Other DBs
NCBI-GeneID: 105060442
NCBI-ProteinID: XP_010942444
LinkDB All DBs
Position
Unknown
AA seq 748 aa AA seqDB search
MLLRASSLSFLKFFAPPPPSFLNPLPFSKFKTLNPSALLCFSSTDGTAMSARRTVAEALM
GGARAAAARKKAKNEKTPAPSPPPDPSPPRPKPTKTLDTPPDEKKKNAALELRKKCSDFN
PRAAAYWKDGEPVPFSFLVHAWELIGKESGRIAMTEILCNAFRTVIATTPGDLLATVYLT
ANKIAPPHEGLELGIGEASLVKALAEAYGRKEEHVKKQNSELGDLGLVAKASRSTQKLMF
QPKPLTIDKVFNTFLAIAKESGTNSHDKKKNHIKGLLVAATECEPLYITRLLQSKMRIGL
AEKTVLVALGQAAAYSETCPKPPLQTQSPFEEAAKIIKQVYSVLPSYDKIVPSLLQVGVW
KLPEACNFTLGVPIGPMLAKPTKAVSEIIDKFQGMEFTCEYKYDGERAQIHYMEDGSVEV
YSRNAERNTGKYPDVVSFISRFKKDTAKSFVLDCEIVAYDHEKQKILPFQVLSTRARKGV
ILSDIKVTVCTFGFDILYLNGQPLLQEQLKVRRQHLYSSFEEVPGVFQFATATITNDVEE
IQKFLEAAVNSSCEGLIIKTLDKDATYEPSKRSNNWLKLKKDYMESIGDSLDLVPIAAFH
GRGKRTGVYGSFLLACYDEQNEEYQTICNIGTGFSESQLEERSASLRNKVIPTPKPYYQY
ADTVNPDVWFEPAEVWEVKAADLSISPVHCAASGIVDPNKGISLRFPRLVRVRDDKSPEQ
ATTSDQVADMYRAQKINHANNHEEEDDD
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgctgttgagagcttcgagtttatcattcctcaaatttttcgctcccccacctccttcc
ttccttaaccccctcccattctctaaatttaaaaccctcaacccctccgccctcctctgc
ttctcctccacagacggcaccgccatgtccgcccgccgaaccgttgccgaggccctcatg
ggcggggcccgcgccgccgcagcccggaagaaggccaagaatgagaaaacccccgcccca
tccccgccaccggatccctcccctcctcgcccgaagcccaccaaaaccctagacacccca
ccggacgagaagaagaagaacgccgccctcgagctccggaagaagtgctccgatttcaac
cctagagccgccgcttactggaaggacggcgagccggtcccgttctcgttcctcgtccac
gcctgggaactgatcggaaaagagtcgggccgcattgccatgacagagatcctctgcaat
gcctttcggacggtgatcgccaccacacccggggatcttcttgccaccgtttacctcact
gcgaacaagatcgctccgcctcatgagggtcttgaacttggaattggagaagcatctctc
gtcaaggcgctcgctgaggcttatggtcggaaggaggagcacgtgaagaagcaaaacagc
gaattgggtgacttgggtcttgttgcaaaagccagccgttcgactcaaaagttgatgttc
cagcctaaacctttgacaatcgacaaggttttcaatacattcctggccattgcaaaggaa
tctggtacaaatagtcatgacaagaaaaagaatcatataaagggacttctggttgcagca
actgaatgtgaacctctgtatataactcgtcttctacagtcaaaaatgcgtatcggtttg
gcagagaaaactgtccttgttgctcttggacaagcagctgcatattctgaaacatgtcca
aagccacctttgcaaactcaatctccctttgaagaggctgcaaaaatcatcaaacaagta
tattctgtacttcctagctatgataaaattgtcccttctcttcttcaagttggggtgtgg
aaacttccagaggcatgcaattttactttaggtgtccctattggacctatgttagcaaaa
ccaacaaaggctgtatcagagatcatcgacaaattccagggaatggagttcacctgtgaa
tacaaatatgatggtgaacgtgcacagatacattacatggaggatggatcagttgaggta
tatagtcgtaacgcagaacggaatactgggaagtaccctgatgttgtcagttttatctca
agattcaaaaaggatactgcaaaatcatttgtgctggattgtgaaattgttgcttatgac
catgagaagcagaaaatcttacctttccaggtccttagcactcgtgctcgtaagggtgtg
atcttaagtgatataaaagtcacagtctgcacctttggctttgatattctgtatttaaat
ggccaacctcttctccaggagcaactcaaagttcgtcgacagcatctctacagttctttt
gaggaagtgccaggagtattccagtttgcaactgctaccataacaaacgatgtcgaggaa
atacagaaattccttgaagcagctgtcaactccagttgtgaaggattgattatcaaaaca
ttggataaagatgccacatatgagccttcaaagcggtctaacaactggctgaagttaaag
aaagattacatggagagcattggtgactcactagatttggtgcctattgctgcattccat
ggtcgtggaaaacgtacaggggtttatggttcgtttcttcttgcttgctacgatgaacaa
aatgaagaataccaaaccatctgtaatataggtactggattttctgagtcacaacttgaa
gagcggtctgcaagccttcgcaataaagtgattcctacaccaaagccatattatcagtat
gctgatacagtgaatccggatgtatggtttgagccagcagaggtttgggaggtgaaagca
gcagatttgagtatcagtcctgttcattgtgctgctagtggcatagtcgatccaaataag
ggcatttctcttcgatttcctcgtttagtgcgtgttcgggatgacaaaagccctgaacaa
gccacaacgtctgatcaggttgctgacatgtatcgtgctcaaaagattaaccatgcaaat
aatcacgaggaagaggatgatgactaa

DBGET integrated database retrieval system