KEGG   Egretta garzetta (little egret): 104124553Help
Entry
104124553         CDS       T05152                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2 isoform X1
  KO
K11987  
prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
egz  Egretta garzetta (little egret)
Pathway
Arachidonic acid metabolism
Metabolic pathways
VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:egz00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    104124553 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    104124553 (PTGS2)
Enzymes [BR:egz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     104124553 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 571 aa AA seqDB search
MTTGFDQYECDCTRTGYYGENCTTPEFFTWLRLTLKPSPNTVHYILTHFKGAWNIVNNVP
FLRDAIMRYVLTSRSHLIDSPPTYNSDYSYKSWEAYSNISYYTRSLPPVGLDCPTPMGVK
GKKELPDSKLIVEKFLLRKKFIPDPQGTNMMFTFFAQHFTHQFFKTDHKKGPGFTKAFGH
GVDLNHIYGETLERQLKLRLLRDGKLKYQMIDGEMYPPTVKDTAAEMIYPPHIPEHLQFS
VGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWDDEQLFQTTRLVLIGETIKIVIE
DYVQHLSGYHFKLKFDPELLFNQRFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQEYTFQQ
FLYNNSIMLEHGLSHMVKSFSKQSAGRVAGGKNLPAAVQKVAKASIDQSRQMRYQSLNEY
RKRFMLKPFKSFEELTGEKEMAAELEELYGDIDAMELYPGLLVEKPRPGAIFGETMVEIG
APFSLKGLMGNAICSPEYWKPSTFGGKVGFEIINTASLQKLICNNVKGCPFTAFHILNPE
PTEATINVSTSKTAMEDINPTLLLKERSAEL
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaggatttgatcagtatgaatgtgactgtacaaggacaggctattatggggaa
aactgtacgacaccggaattcttcacgtggctgaggctaacattgaaaccttcaccaaat
actgtccactacatcctcacccacttcaaaggagcctggaatatcgtcaacaatgttccc
ttcttacgagatgctattatgagatacgtattaacgtcaagatcacacttgattgatagc
ccaccaacttacaatagtgattatagttacaaaagctgggaagcttattccaatatttcc
tattacacaagaagccttccaccagtaggacttgactgcccaacaccaatgggtgttaaa
ggtaagaaagagctcccagattcaaagctgattgtggagaagtttttgctaaggaaaaaa
ttcattcctgacccacaaggcacaaacatgatgttcacattctttgcccaacacttcacc
catcagttctttaagacagaccacaagaaaggacctggcttcactaaagcttttggccat
ggggttgacttgaaccatatttatggggagactctggagagacaacttaaactgagactt
ctaagggatggaaagctaaaataccagatgattgatggagaaatgtatccaccgacagta
aaggacactgccgcagagatgatctaccctcctcacatacctgaacacttgcagttttct
gtcgggcaggaggtgtttggtttggtcccaggtttgatgatgtatgctacaatatggctg
agggaacacaaccgcgtctgtgacatcctgaaacaggagcatccggagtgggatgatgag
cagctgttccaaactactagactcgtattgataggagagaccatcaagatcgttatcgag
gactatgtgcaacacttgagcggctaccacttcaaactcaagtttgatcctgagctgctg
ttcaaccagcgatttcagtaccagaaccgaattgcagctgaattcaatactctctaccac
tggcacccacttctgcctgacactttccagatacacgaccaggagtacactttccagcag
ttcctctacaacaactctataatgctggaacatggcctttcccatatggtgaaatctttc
tccaagcaaagtgctggcagggttgctggtgggaaaaaccttcctgctgcagtacagaaa
gtagcaaaggcttcaattgaccagagcagacaaatgcgataccagtccttgaatgagtac
aggaaacgcttcatgttgaaaccattcaaatcatttgaagaactcacaggagaaaaagaa
atggcagctgaactggaagaactttatggagacattgatgctatggagctgtacccaggc
cttctcgtagaaaagccacgaccaggtgccatcttcggtgaaacaatggtggagattgga
gcaccgttctctctgaaaggactgatgggaaatgctatctgctcccctgagtactggaag
cctagcacctttggtggaaaagtaggctttgaaataatcaatactgcctccttacagaag
ctcatctgcaacaatgtgaaaggctgtcctttcactgctttccacatcttgaatcctgaa
cccacagaggcaactattaatgttagtacctcaaaaacagcaatggaagatatcaacccc
acactgctactgaaagagcgatctgccgagttgtaa

DBGET integrated database retrieval system