KEGG   Edwardsiella hoshinae: A9798_01880Help
Entry
A9798_01880       CDS       T04508                                 

Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
eho  Edwardsiella hoshinae
Pathway
eho00564  Glycerophospholipid metabolism
eho01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eho00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    A9798_01880
Enzymes [BR:eho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A9798_01880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 Fer2_BFD FAD_binding_3 FAD_oxidored DAO_C Thi4 Pyr_redox_2 NAD_binding_8 3HCDH_N HI0933_like Pyr_redox_3 K_oxygenase GIDA Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AOV95820
UniProt: A0A1D8MUZ3
LinkDB All DBs
Position
424221..425870
Genome map
AA seq 549 aa AA seqDB search
MLQSPASQETDVVIIGGGATGAGIARDCARRGLRCILLERHDIATGATGRNHGLLHSGAR
YAVTDGESARECIEENRILKRIARHCVERTDGLFITLPEDDLAYQPRFIEACRAAGIEAE
AIDPAEALRLEPAANPNLLGAVRVPDGTVDPFRLTAANMLDAREHGGQALTYHEVCGLLR
QGDRVTGVRVLDHKSGQRYDIHAQIVVNAAGIWGQHIAEYADLRIKMFPAKGALLILGHR
INNMVINRCRKPADADILVPGDTISLIGTTSTHIDYDQIDNMIVTPQEVDVLIREGEKLA
PKLAATRILRAYAGVRPLVASDDDPSGRNVSRGIVLLDHAARDGMEGFITITGGKLMTYR
LMAEWATDKVCEKLGVSTPCTTASEPLPGSEHSAEETLRKVISLPAPIRGSAVYRHGDRA
DRLLNGDRLNSSLVCECEAVTAGEVRYAVDSLTVNNLVDLRRRTRVGMGTCQGELCACRA
AGLLNRFKVTTPQQSIAQLSHFLNERWKGIRPIAWGDALRESEFTSWVYQGLCGMDAEPP
QRGENDDEI
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgttacagagccccgcatcacaggaaactgacgtcgtcattattggcggtggcgccaca
ggcgccggcatcgcccgtgactgcgcgcgccgcggcctgcgttgcattctgctggagcgc
cacgacatcgccaccggcgcgaccggccgtaaccatggtttgctgcacagcggcgcccgc
tatgcggtgaccgacggagagtccgcgcgcgaatgtattgaagagaaccgtattctcaag
cgcatcgcccgccattgcgtcgagcgtaccgacgggctgtttatcaccctgccggaagac
gatctggcctatcagccgcgctttattgaggcctgccgcgccgcgggtatcgaggctgaa
gccatcgatccggccgaggcgttgcgcctggagcctgccgccaacccgaatctgctaggc
gcggtgcgcgtgccggacggcaccgtcgatcctttccgcctgacggcggccaatatgctg
gatgcgcgtgaacatggcggccaggcgctgacctatcacgaggtgtgcggcctgctgcgc
cagggcgatcgggtaaccggtgtgcgcgttctcgaccataagtcgggccagcgctacgac
atacacgcccagatcgtggtgaacgccgccgggatctgggggcagcacatcgccgagtac
gccgatctgcgcatcaagatgtttccggccaagggggcgctgttgatcctcggccaccgc
atcaacaacatggtgatcaaccgttgccgtaagccggcggatgccgacatcttggtgcca
ggtgatacgatctcgctgatcggcaccacctcgacccatatcgactacgatcagatcgac
aatatgatcgtcaccccgcaagaggttgatgtcctgatccgtgaaggcgaaaagttggcg
ccgaagctggcggcaacccgcattctacgtgcctatgccggggtgcggccgttggtggcc
agcgacgatgatcccagcggccgtaacgtcagccgcggcatcgtactgctcgatcacgcc
gcgcgcgatgggatggaggggttcatcaccatcaccggcggtaagctgatgacctaccgg
ctgatggccgagtgggccacggataaagtgtgtgagaagctgggcgtcagtacgccctgt
accacggccagcgagccattgcccggctccgagcactctgccgaggagacgctacgcaaa
gtgatctccttgcccgccccaatccgcggttcggcggtgtatcgccacggtgatcgcgcc
gatcgcctgctgaacggcgatcgcctcaacagtagcctggtgtgcgagtgcgaggcggtg
accgccggtgaggtgcgctatgcggtggattcgctgacggtgaataacctggtggatctg
cgccgtcgtacccgcgtgggaatgggcacctgtcagggtgagctgtgcgcttgccgcgcc
gccggtctgctgaatcgctttaaggtcactacaccgcaacaatccatcgcgcagctctcc
cacttcctgaacgagcgttggaaggggatccgcccgatcgcttggggcgatgccttgcgc
gaaagcgaatttaccagttgggtgtatcaaggattatgcggtatggacgccgagccgccg
cagcgtggggagaatgacgatgaaatttga

DBGET integrated database retrieval system