KEGG   Edwardsiella hoshinae: A9798_02875Help
Entry
A9798_02875       CDS       T04508                                 

Definition
(GenBank) glutaminase
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
eho  Edwardsiella hoshinae
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eho00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A9798_02875
   00220 Arginine biosynthesis
    A9798_02875
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    A9798_02875
Enzymes [BR:eho01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     A9798_02875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
673196..674131
Genome map
AA seq 311 aa AA seqDB search
MTLDVQRIQQVVEQAYRQFATAAGGKNADYIPYLASVPSQLAALAIVTHDGAVYCAGDSA
YRFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVMALELHRGKPLSPLVNAG
AMAAASLIQASDREQRWQRILTIQQQLAGEKVALSDEVNQSEQTTNFHNRAIAWLLYSAG
TMYCDPMEACDVYTRQCSTLIDTVELATLGATLAAGGVNPRSGQRVLQRANVPYILAEMT
MEGLYGRSGDWAYHVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEAGNSVRGQKMVAEV
AAQLGYNLFRA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacgttagatgtacaacgtattcagcaggtggtcgagcaggcgtaccggcagtttgca
acggcggcgggagggaaaaacgccgactatattccctatttggccagtgtgccgagccaa
ttggcggcgctggccatcgtcacgcatgacggcgcggtgtactgcgccggcgacagcgcc
tatcgctttgcgttggagtcgatttccaaggtatgcaccttggcgctggcgttagaagat
gtcggaccgcaggcggtgcaggataagatcggcgccgatccgaccggcctgccgtttaac
tcggtgatggcgttggagttacatcgcggcaagcccttgtcgccgctggttaacgccggg
gcgatggcggcggcgagcctgattcaggcaagcgatcgcgagcaacgttggcaacgcatc
ctgaccatccagcagcagctggcgggagagaaagtggcgctgtcggacgaggtgaaccag
tcagagcagaccaccaacttccataatcgcgccatcgcctggctgctctattccgccggg
acgatgtattgcgacccgatggaggcctgtgacgtgtatacccgccaatgctcgacgctg
atcgataccgtcgaactggcgaccctgggggcgaccctggcggcaggcggggtgaatcca
cgcagcgggcagcgcgtgctacagcgtgctaacgtcccctatatcctggccgagatgacc
atggagggcttgtatggccgctctggcgactgggcctaccatgtcggcctgccgggtaag
agcggcgtaggcggtggcattctggcggtggtgcccggggtgatggggattgcggccttc
tcgccaccgttggatgaggcaggcaacagcgtccgcgggcagaagatggtggcagaggtc
gcagcacaactgggctataacctgtttagggcctaa

DBGET integrated database retrieval system