KEGG   Emiliania huxleyi: EMIHUDRAFT_442957Help
Entry
EMIHUDRAFT_442957 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
Organism
ehx  Emiliania huxleyi
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 17273834
NCBI-ProteinID: XP_005780718
JGI: Emihu1_442957
UniProt: R1F4Y6
LinkDB All DBs
Position
Unknown
AA seq 434 aa AA seqDB search
MNEPFQALHNLPSADEVVRLLYKRDAFKKAPYGVNSLATWFANVAIHDFFRTATGTDGGT
HPERGSDKEWVNLHSSYLDLQPLYGYSKTTADATREWSGGKLKAFAEDRMRRIPESRVIV
ELLRREHNYVAEQLAQRYPAQFATDEELYQQARLIMGGVYINIILRAYGCQMFGEIAPDG
SGFCELRQGYGGAGVGNMCTFNFNLIYRFHTSIPVEWSATDPPPIDTDEQMRTLLNGILN
WESGGFGPNNVPDSILGERARVSQRAIEAARLMGAPTLNTFRRRFTSGYSSFEDMTGGDQ
ATADTLRQLYPGGIEDVELVVGCQVEKCMSGGWALPSTIGQAIVADAFASIRQDRFYTQD
WGASSYTAWGFEHAKSTVLADVINRHLGTNSFSVNRLVGLEKLPDWAGPPEWSQVVSFNE
RGFPILKEDSPGGV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagcccttccaggccctgcacaacctgccttcggcggacgaggtggtgcggctg
ctctacaagcgggacgccttcaaaaaggcaccgtacggcgtcaactcgctcgcaacttgg
ttcgcaaacgtcgccatccacgactttttccgcaccgcgaccggcacagacggcggcacg
cacccggagcgaggcagcgacaaggagtgggtcaacctccactcctcgtacctcgacctg
cagccgctgtacggctactcgaagacgacggccgacgccacgcgcgagtggagcggcggc
aagctcaaggcgtttgcggaggaccggatgaggcggatccccgagtcgcgagtcatcgtc
gagttgctgcggcgcgagcacaactacgtggcggagcagttggcgcagcgctaccccgcg
cagtttgccaccgacgaggagctctaccagcaggcgcggctcatcatgggcggcgtgtac
atcaacatcatcctccgcgcctacggctgccagatgtttggcgagatcgcgccggacggg
tcgggcttctgcgagctgcggcaggggtacggcggcgccggggtgggcaacatgtgcacc
ttcaacttcaacctcatctaccgcttccacacgtccatcccggtggagtggtccgcgaca
gacccgccgccgatcgacacggacgagcagatgcgcacactgctcaacggcatcctcaac
tgggagtcgggcgggttcggtccgaacaacgtgcccgactcaatcctcggggagcgggcg
cgcgtctcgcagcgcgccatcgaggcggcgcggttgatgggcgctcccacgctcaacacc
ttccgccgccgcttcacgagcggctactcctccttcgaggacatgacgggcggcgaccag
gccaccgccgacacgctgcggcagctctacccgggcggcatcgaggacgtcgagctcgtc
gtcggctgccaggtcgagaagtgcatgagcggcgggtgggcgctgccctccaccatcggg
caggcgatcgtcgcggacgccttcgcgtcgatccggcaagaccgcttctacacgcaggac
tggggtgcgtccagctacaccgcgtggggcttcgagcacgctaagagcacggtgctcgcc
gatgtcatcaaccgccacctcggcaccaactccttctccgtcaaccggctcgtcgggctc
gagaagctgccggactgggcgggaccgcccgagtggtcgcaggtcgtgagcttcaacgag
cgcggcttccccatcctgaaggaggactcgccgggaggggtgtag

DBGET integrated database retrieval system