KEGG   Entamoeba invadens: EIN_052520Help
Entry
EIN_052520        CDS       T04133                                 

Definition
(RefSeq) thymidine kinase, cytosolic, putative
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
eiv  Entamoeba invadens
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eiv00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    EIN_052520
Enzymes [BR:eiv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     EIN_052520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 245 aa AA seqDB search
MEIDTTVLLSPVVQKDDMKKTYDGSIQLIMGPMFSGKTTELIRLIKRFTVSKKRTVILKY
TKDVRYGEVNEAVSHDQEKWEAIPTMELMPCVKEALHYDVIGIDEGQFFPDLLEFSELMA
DYGKRVIIAALDGTFQRKVFGQITDIVPLCESVRKLRAVCVFCGNKASFSMRTTEEESVE
VIGGAEKYCAVCRKCYHDKCVFPQTRKINDFIEPSEKRKRKDHEKLDQWSSLIIPSAICE
DSQTA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcgacacaacagtccttcttagcccagttgttcaaaaagatgacatgaagaag
acgtacgacggctccatccagttaattatgggcccaatgttttctggaaagacgacggag
ctaatccgcctcatcaagcggtttacagtctcgaagaagcggacagtgatcttgaagtac
accaaggacgtgaggtatggcgaagtcaatgaagctgtttcgcatgatcaagagaagtgg
gaagcgattcccacgatggaattgatgccgtgtgtcaaagaagcacttcattatgatgtt
atagggattgatgaagggcaattcttccccgacttactcgagttctccgagttaatggcg
gactatggaaaacgtgtgattatagctgcacttgatgggaccttccagagaaaagtattt
gggcagatcaccgacatcgttcctttatgtgaaagtgtccggaagctccgagcagtctgt
gtgttttgtggcaacaaagcttcattctcgatgcgaacgacagaagaagagagtgttgaa
gtcataggtggtgctgaaaagtattgtgcagtgtgtagaaaatgttatcacgacaagtgt
gtcttcccacagactcggaagatcaacgacttcatcgagccttccgagaaaaggaaaaga
aaagatcacgagaagcttgaccagtggtcttccctaataatcccatcagcaatttgtgag
gacagccagaccgcgtga

DBGET integrated database retrieval system