KEGG   Enterobacter kobei: BFV64_00905Help
Entry
BFV64_00905       CDS       T04686                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
ekb  Enterobacter kobei
Brite
Translation factors [BR:ekb03012]
 Eukaryotic Type
  Elongation factors
   BFV64_00905
 Prokaryotic Type
   BFV64_00905
Mitochondrial biogenesis [BR:ekb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BFV64_00905
Exosome [BR:ekb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BFV64_00905
  Exosomal proteins of breast cancer cells
   BFV64_00905
  Exosomal proteins of colorectal cancer cells
   BFV64_00905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
186737..187921
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgcaatcactaccgttctggctaaaacctac
ggtggttctgctcgtgcattcgaccagatcgataacgcaccagaagaaaaagctcgtggt
atcaccatcaacacttctcacgttgaatacgacaccccgactcgccactacgcacacgta
gactgcccaggccacgccgactatgttaaaaacatgatcaccggtgctgcgcagatggac
ggcgcgatcctggttgttgctgcgactgacggcccaatgcctcagactcgtgagcacatc
ctgctgggtcgtcaggtaggcgttccttacatcatcgtgttcctgaacaagtgtgacatg
gttgatgacgaagagctgctggaactggtagagatggaagttcgtgaactgctgtctcag
tacgatttcccaggcgacgacaccccaatcgttcgtggttccgcgctgaaagcgctggaa
ggcgacgctgagtgggaagcgaaaatcatcgaactggctggctacctggattcttacatc
ccagaaccagagcgtgcgattgacaagccattcctgctgccaatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagagcgcggtatcatcaaagttggt
gaagaagttgaaatcgttggtatcaaagagactgcgaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgttggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggttctggcgaagccaggctcaatcaag
ccacacaccaagttcgaatctgaagtgtacatcctgtccaaagacgaaggcggccgtcat
actccgttcttcaaaggctaccgtccacagttctacttccgtacaactgacgtgaccggt
accatcgaactgccagaaggcgttgagatggtaatgccaggcgacaacatcaagatggtt
gtgactctgatccacccaatcgcgatggatgacggtctgcgtttcgcaatccgtgaaggt
ggccgtaccgttggcgcgggcgtggttgctaaagttctcggctaa

DBGET integrated database retrieval system