KEGG   Eutypa lata: UCREL1_1175Help
Entry
UCREL1_1175       CDS       T03103                                 

Definition
(RefSeq) putative superoxide dismutase protein
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ela  Eutypa lata
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:ela00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    UCREL1_1175
Enzymes [BR:ela01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     UCREL1_1175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 234 aa AA seqDB search
MATSLFRTAPTVRAALRAGSAKPRVAASLAGTSFVRGKATLPDLSYDYGALEPHISGKIM
EIHHKGHHQTYVTNLNAALEQISEAKEKNNEIAAASLASALNFNGGGHTNHTLFWENLAP
NNKGGGGEPEGTLKSAIEKDFGSFDTLKKQITAALAGIQGSGWAWLVKDKTTGALQVVTR
PNQDPVVGNQAPLLGIDAWEHAYYLQYQNRKAEYFSAIWNVINWSTVASRLEKS
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggccacctcgcttttccgcaccgcccctacagtccgagccgctctgcgagccggttcc
gcgaagccccgtgtcgctgcttcgttagcggggacatcgttcgtccgaggcaaggccaca
ctccccgacctatcatacgactatggcgccctggagccgcacatctccggcaagatcatg
gagatccaccacaagggccaccaccagacctacgtcacgaacctgaacgcggcgctggag
cagatctccgaggccaaggagaagaacaacgagatcgccgccgcctcgctcgcctccgcc
ctcaacttcaacggcggcggccacaccaaccacaccctgttctgggagaacctggccccc
aacaacaaggggggtggtggtgagcccgagggcaccttgaagtccgccatcgagaaggac
ttcggctccttcgacaccctcaagaagcagatcaccgccgccctagccggcatccagggc
agtggctgggcgtggctggtgaaggacaagacgacgggcgcgctgcaggtggtgacgcgc
ccgaaccaggaccccgtcgtcggcaaccaggccccgctgctgggcatcgacgcctgggag
cacgcctactacctgcagtaccagaaccgcaaggccgagtacttcagcgccatctggaac
gtcatcaactggtctaccgtggccagcaggctggagaagtcgtaa

DBGET integrated database retrieval system