KEGG   Eutypa lata: UCREL1_1744Help
Entry
UCREL1_1744       CDS       T03103                                 

Definition
(RefSeq) putative alpha-amylase a type-3 precursor protein
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
ela  Eutypa lata
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ela00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UCREL1_1744
Enzymes [BR:ela01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     UCREL1_1744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 449 aa AA seqDB search
MRTSYTSSLLAALGLFTSAVSAADTAAWKSRNIYFALTDRVARSSGDTGGNACGDLSTYC
GGTFQGLQSKLDYIQGMGFDAIWITPVVANSAGGYHGYWAQDLYSVNSNYGTADDLKSLV
NAAHDKGIYIMVDVVANHMGFAAIGDNKPEPLNQQSSYHAQCDIDYSNQNSIETCRIAGL
PDVNTSSEEIRALYQEWIAWLHVEKEFWTPFSAAAGVYTIGEVFDGNPDYLAGYASTMSG
LLNYAIYYPMNAFYQQTGASQAIVDMHDTIDSKFPDPSALGTFLDNHDNARWLNAKSDAQ
LLKNALAYVILARGIPIVYYGTEQGYSGGADPANREDLWRTSFNTDADLYQAISKLSSAR
AAAGGLAANDHDHLYVADTAYAWARAGGNLIVLTTNSGSGSSGQHCFNTQVPNGSWTDTF
GEGTAYTADGSGNVCVNVTNGAPVVLVAA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacttcgtacacctcctcgctgctcgccgcccttgggctgttcacctcggccgtc
tcggcggccgatacagcggcgtggaaaagtcgaaacatctactttgccctgacggatcgg
gttgcgcgtagcagcggcgatacgggcggcaatgcgtgcggcgacctctcgacctactgt
ggcggtaccttccaaggtctccagtctaagctcgactacatccagggaatgggcttcgat
gctatttggatcacgcctgtcgttgccaacagcgctggaggttaccatgggtactgggcg
caggacctctactccgtaaactcgaattacggaacagctgatgacttgaagagcttagtc
aatgcagctcacgataagggcatatacatcatggtggacgtagtggccaaccacatgggc
ttcgcggccattggcgacaacaagccagagccgctgaaccagcagagctcgtaccacgcg
caatgcgacatcgactactcgaaccagaacagcatcgagacgtgccggatcgccggactg
cccgacgtcaacacgtcgagcgaggagatccgcgccctctaccaggagtggatcgcgtgg
ctccacgtcgagaaggagttctggacgccgttctcggccgcggcgggcgtgtacaccatc
ggcgaggtcttcgacgggaaccccgactacctcgccggctacgcgagcaccatgtcgggc
ctcctcaactacgccatctactaccccatgaacgccttctaccagcagacgggcgcgagc
caggccatcgtcgacatgcacgacacgatcgactccaagttcccggacccctcggccctc
ggcaccttcctcgacaaccacgacaacgcgcgctggctcaacgccaagtccgacgcccag
ctgctcaagaacgccctcgcctacgtcatcctcgcccgcggcatccccatcgtgtactac
gggaccgagcagggctacagcggcggcgccgacccggccaaccgcgaggacctctggcgc
acctccttcaacaccgacgccgacctctaccaggccatctcgaagctgtcgagcgcgcgc
gccgccgccggcggcctcgccgctaacgaccacgatcacctgtacgtcgcggacaccgcg
tacgcgtgggctcgcgcgggtggcaacctcatcgtgctcacgaccaacagcggttccggc
tcttccggccagcactgctttaacacccaggtgcccaatggctcgtggaccgatacgttt
ggcgaggggaccgcgtacacggccgacggaagcgggaatgtttgcgtcaatgtcacgaat
ggcgcgccggttgttttggttgctgcttaa

DBGET integrated database retrieval system