KEGG   Eutypa lata: UCREL1_2940Help
Entry
UCREL1_2940       CDS       T03103                                 

Definition
(RefSeq) putative set domain protein
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
ela  Eutypa lata
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ela00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    UCREL1_2940
Enzymes [BR:ela01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     UCREL1_2940
Chromosome [BR:ela03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     UCREL1_2940
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    UCREL1_2940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 351 aa AA seqDB search
MEEATRQHFFTHGEPGHEQEKENCHFCQLRAFATHAQYPVTIINTEDDAVLDPSFRFTDN
SVLSSGVEPTTDEFRSGCACLDGEACQYKGCHCLQDMDDDDDDDNAHNNNNNNNYEDDDE
DDDTASADPYASQYRKKTYVYHSHGARAGHLRSKILTSRDPIYECHERCTCSAAEFGCPN
RVVERGRRVPLQVFRTANRGWGVRSTVDVRKGQFVDKYVGEVITAAEANRRRAQSHIAQR
KDVYLFALDKFWDPESLDERLRGPPLEVDGELLSGPTRFVNHSCDPNLRIFARVGDHADK
HIHDLALFAIRDIPKGEELTFDYVDGVHDEDNDALDPEKQKDMTRRHLQIM
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggaagaggctacaagacagcatttcttcacccacggggaaccaggtcacgagcaagaa
aaggagaactgccatttctgccagctgcgcgccttcgcgacgcatgcccagtaccccgtg
acgataatcaacacagaagacgacgcagtgctggaccccagcttccgcttcaccgataat
tcggtgctgagcagcggcgtggagccgactacggacgagttccggtcggggtgcgcctgc
ctcgacggtgaggcctgccagtacaagggctgccattgcctgcaggacatggacgatgac
gacgacgacgataacgcccacaacaacaacaacaacaacaattacgaagatgacgatgaa
gacgacgacaccgcttccgccgacccctacgcgtcgcagtaccgcaagaagacgtacgtg
taccactcgcacggggcgcgggcgggccacctccgctcgaagatcctgacgtcgcgggac
ccgatctacgagtgccacgagcggtgcacgtgcagcgcggcggagttcgggtgcccgaac
cgggtggtggagcgcgggcgccgcgtcccgctgcaggtgttccgcacggcgaaccggggg
tggggcgtccggagcacggtggacgtgcgcaagggccagttcgtcgacaagtacgtgggc
gaggtgatcacggcggccgaggcgaaccggcgccgcgcccagtcccacatcgcgcagcgc
aaggacgtctacctgttcgcgctcgacaagttctgggacccggagtcgctggacgagcgc
ctgcggggcccgccgctcgaggtcgacggcgagctcctgtccggccccacgcgcttcgtc
aaccattcgtgcgatccgaatttgaggattttcgcgcgcgtgggcgatcatgccgataag
catattcatgacctggcgctgtttgcgatccgggatatcccgaagggggaggagttgacg
tttgattatgtcgatggggtccacgacgaggataatgacgccttggaccccgagaagcag
aaggatatgacgcgtcgacatttgcagattatgtga

DBGET integrated database retrieval system