KEGG   Eutypa lata: UCREL1_3856Help
Entry
UCREL1_3856       CDS       T03103                                 

Definition
(GenBank) putative mitogen-activated protein kinase protein
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ela  Eutypa lata
Pathway
ela04011  MAPK signaling pathway - yeast
ela04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ela00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    UCREL1_3856
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    UCREL1_3856
Enzymes [BR:ela01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     UCREL1_3856
Protein kinases [BR:ela01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   UCREL1_3856
Chromosome and associated proteins [BR:ela03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     UCREL1_3856
Exosome [BR:ela04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   UCREL1_3856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like Gag_p6 APH S_100 Seadorna_VP7
Motif
Other DBs
NCBI-ProteinID: EMR69124
UniProt: M7SRN8
LinkDB All DBs
Position
Unknown
AA seq 355 aa AA seqDB search
MSRPNQPGGAGSRKISFNVSEQYDIQDVVGEGAYGVVCSAIHKPSGQKVAIKKITPFDHS
MFCLRTLREMKLLRYFNHENIISILDIQKPRNFETFNEVYLIQELMETDMHRVIRTQDLS
DDHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASQEDNSG
FMTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILD
VLGTPTMEDYYGIKSRRAREYIRSLPFKKKVPFRTLFPKTSDLALDLLEKLLAFNPVKRI
TVEEALKHPYLEPYHDPEDEPTAPPIPEEFFDFDKHKDSLSKEQLKQLIYNEIMR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgacctaatcaacccggcggagccggatctcgtaagatctcattcaatgtgagc
gagcagtacgatattcaggatgttgttggcgagggtgcttacggtgtcgtctgttcggcg
atacacaagccttcgggccagaaggtggccatcaagaagatcacacctttcgaccactcc
atgttctgcctgagaacgttgcgagagatgaagcttctccgatacttcaaccacgagaac
attatttccatcctcgacatccaaaaacctcggaactttgagaccttcaatgaagtctat
cttatccaggaactcatggagacggacatgcaccgagtcattcgcacccaggacctgtcg
gatgaccattgccagtacttcatctatcaaacccttcgcgccttaaaggctatgcactct
gcgaatgtgttgcaccgagacctgaagccgagcaatctgctgttgaatgcgaactgcgac
ttgaaggtctgcgacttcggtctggcccgatcagctgcatctcaagaggacaactcgggc
ttcatgacggaatacgtggcgactcgttggtatcgtgcgccggagatcatgttgaccttc
aaggagtacaccaaggccattgacgtctggtctgttggctgtatcttagctgagatgcta
agcggcaagcccctgttccctggaaaggactaccatcaccaattgaccctgatccttgat
gtccttggcaccccgactatggaagattattatggcatcaagtctcgtcgtgcccgagag
tacatccgatcattacccttcaagaagaaggtaccattccgcaccttgttccccaagact
tcggacctagctcttgacctgctcgagaagctcttagcgttcaatcctgtcaagcgcatc
actgtggaggaggcactcaagcacccgtaccttgagccataccatgacccggaggacgag
ccgacggcacctccgatccccgaggaattcttcgacttcgacaagcacaaggacagtctt
agcaaggaacaactgaagcaactcatctacaacgagattatgcggtag

DBGET integrated database retrieval system