KEGG   Eutypa lata: UCREL1_7642Help
Entry
UCREL1_7642       CDS       T03103                                 

Definition
(GenBank) putative glutamate decarboxylase protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ela  Eutypa lata
Pathway
ela00250  Alanine, aspartate and glutamate metabolism
ela00410  beta-Alanine metabolism
ela00430  Taurine and hypotaurine metabolism
ela00650  Butanoate metabolism
ela01100  Metabolic pathways
ela01110  Biosynthesis of secondary metabolites
Module
ela_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ela00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    UCREL1_7642
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UCREL1_7642
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UCREL1_7642
   00430 Taurine and hypotaurine metabolism
    UCREL1_7642
Enzymes [BR:ela01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     UCREL1_7642
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: EMR65384
UniProt: M7SGI1
LinkDB All DBs
Position
Unknown
AA seq 528 aa AA seqDB search
MTTSHLTPYSSKYASKLEVPKYQIPKEGSPADSVYQVIRDELDLDGKPNLNLASFVGTYL
EPTANSLMMENLNKNLADNDEYPAMLSIHERCISMLASLWGARKGVKAVGSATTGSSEAV
HLGGLAMKRRWQEARQARGKDSSKPNIIMGANAQVALLKFARYFDVEARILPVSKKSNYC
LDPDLVKENVDENTIGVFVILGSTYTGHYEPVEEISKLLDEFEENTGIDIPIHVDAASAG
FVAPFTYAQAGGPKWNFELPRVKSINASGHKYGLVTPGVGWIIWRDESFLPQHLIFELHY
LGGTEKSFTLNFSRPGAHVIIQYYNLVHLGFEGYREIMENCLRNARVLSKSLEATKWYTC
LSDIHRANSAVRSALTDAKTAAVGEDGESSADYVAGLPVVSFRFSDEFKREFPHIKQESV
SLLLRARQWIIPNYALPPREDQTEILRICVRESMNLGLLDRLISDVVSVTQSLIDNDKQD
LSILKQQQQRPPGQSGPIQQLRDEAREESEEIALESKRLAGGIHRTVC
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctctcatcttaccccttattcgagcaagtacgcaagcaagctagaggtgccg
aaataccagatccccaaggaaggatctcccgcagattccgtgtaccaggtcatccgtgac
gagttggacctcgacggcaagcccaacctgaatctcgccagcttcgtcggcacgtacctg
gagcccacggccaactccctcatgatggagaacctgaacaagaacctggccgacaacgac
gagtaccccgccatgctgtccatccacgagcggtgcatcagcatgctcgccagtctctgg
ggcgcccgcaagggcgtgaaggccgtggggtcggccaccaccggatcctccgaggccgtc
cacctcggcggcctggccatgaagcgccggtggcaggaggctcgccaggcccgggggaaa
gactcctccaaacctaatatcatcatgggcgcgaacgcgcaggtggcgctcctaaagttc
gcccgctatttcgacgtcgaggcccgcatcctaccggtgtcgaagaagagcaactactgc
ctcgacccggacctcgtgaaggagaacgtcgacgagaatacgattggggtgttcgtgatt
ctgggaagcacttacaccggtcattatgaaccagtagaggaaatctcgaaactactcgac
gaattcgaagagaacacaggaattgatattcccattcatgtcgacgccgcctcagccggc
tttgttgcccctttcacttatgcccaggccggtggacccaagtggaactttgaacttccg
cgtgtcaagtcgatcaatgcctccggccacaagtacggcttggtcacgcccggtgtcggc
tggataatctggcgtgacgagtccttcctcccccaacatctcatcttcgagctgcactat
ctaggagggaccgagaagtcgttcacgctcaacttctcccggcccggcgcgcacgtcatc
atccaatactacaacctggtccacctcggcttcgaggggtaccgagagatcatggagaac
tgtctccgcaacgcgcgcgtcctatccaagagcctcgaagctacgaagtggtatacgtgc
ctctcggatatccaccgcgcgaactctgccgtacgcagcgcgttgacagatgccaagacg
gcagctgtgggcgaggacggcgagagttctgccgactacgtggccggtcttcccgttgtg
tccttccggttctcggatgagttcaagagggagttcccgcacatcaagcaggagtccgtc
tccctcctcctgcgggcgcggcagtggatcataccgaactacgcgctcccgccgcgcgag
gaccagacggaaatcctgaggatatgcgtccgcgagagcatgaacctcggcctcctcgat
cgcctgattagcgacgtcgtctcggtcacgcagagtctcatagacaacgacaagcaggac
ttgtccatcctgaagcagcagcagcagcggcctccgggccaatcgggtcctatccagcaa
ctcagagatgaggcgcgagaagagtccgaggagatagcgctggagtcgaagaggctggca
gggggtatccatcggactgtgtgctga

DBGET integrated database retrieval system