KEGG   Escherichia coli LF82: LF82_0866Help
Entry
LF82_0866         CDS       T00854                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
elf  Escherichia coli LF82
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:elf00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    LF82_0866 (glpD)
Enzymes [BR:elf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LF82_0866 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
3598685..3600190
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGANSVLKPEIKRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKYTWQARGLVNATGPWVKQFFDDGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNTHF
KKQLSRDDIIWTYSGVRPLCDDESDSPQAITRDYTLDIHDEDGKAPLLSVFGGKLTTYRK
LAEHALEKLTPYYQGIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLARHYART
YGSNSELLLGNAGAISDLGENFGHEFYEAELKYLVDHEWVRRADDALWRRTKQGMWLNAD
QQSRVSQWLMEYTQQRLSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggtggcggcatcaatggtgctggtatcgcggca
gacgccgctggacgcggtttatccgtgctgatgctggaggcgcaggatctcgcttgcgcg
acctcttccgccagttcaaaactcattcacggtggcctgcgctaccttgagcactatgaa
ttccgcctggtcagcgaggcgctggctgaacgtgaagtgctactgaaaatggccccgcat
atcgccttcccgatgcgttttcgcctgccgcatcgtccgcatctacgcccggcgtggatg
attcgcattggtctgtttatgtacgatcatctgggtaaacgcaccagcctgccgggatca
accggtttgcgttttggcgcaaactcagtgttaaaaccggaaattaagcgcggattcgaa
tattctgactgttgggtagacgacgcccgtctggtactcgccaacgcccagatggtggtg
cgtaaaggcggtgaagtgcttactcgtactcgtgccacgtctgctcgccgcgaaaacggc
ctgtggattgtggaggcggaagatatcgataccggcaaaaaatatacatggcaggcgcgc
ggcctggttaatgctaccggcccgtgggtgaaacaatttttcgacgacgggatgcatctg
ccttcgccttatggcattcgcctgatcaaaggcagccatattgtggtgccgcgtgtgcat
acacagaagcaagcctacattctgcaaaacgaagataaacgtattgtcttcgtgatcccg
tggatggacgagttttccatcatcggcaccaccgatgtggaatacaaaggcgatccaaaa
gcagtgaagattgaagagagtgaaatcaattacctgttgaaagtgtataacacgcacttt
aaaaagcagttaagccgggacgatatcatctggacctactccggcgtgcgtccgctatgt
gatgatgagtccgactcgccacaggccattacccgtgattacacccttgatatccatgat
gaagacggcaaagccccgctgctgtcggtattcggcggtaagctgaccacctaccgcaaa
ctggcggagcacgcgctggaaaaactgacgccatattatcagggcattggtccggcgtgg
acgaaagagagcgtgctgccgggtggtgccattgaaggcgaccgtgacgattacgccgcc
cgcctgcgccgccgttacccgttcctgaccgaatcgctggcacgtcactacgcgcgcact
tacggcagcaacagcgaactgttgctcggcaatgcaggggcgataagcgacctcggtgaa
aatttcggtcatgagttctacgaagcggagctgaaatatctggtcgaccacgaatgggtc
cgccgcgccgacgatgccctgtggcgtcgcacgaaacaaggcatgtggctaaatgcggat
caacaatctcgtgtgagtcagtggctgatggaatatacgcagcagaggttgtcgctggcg
tcgtaa

DBGET integrated database retrieval system