KEGG   Enterobacter ludwigii: BH714_05925Help
Entry
BH714_05925       CDS       T04719                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
elg  Enterobacter ludwigii
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:elg00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BH714_05925
Enzymes [BR:elg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BH714_05925
Transporters [BR:elg02000]
 Other Transporters
  Pores ion channels [TC:1]
   BH714_05925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1234656..1235261)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLRESGKDFTLDGVDLMKKRLENGDDFFAINPKGQVPALLLDDG
TLLTEGVAIMQFLADSVPDRQLLAPVSTVSRYKTLEWMNYIATELHKGFTPLFRPETPEE
YKPTVRAQLEKKLQYVNASLKDDQWIGGARFTIADAYLFTVLRWARAIKLNMDGLDHIAS
YMDRVAARPAVAAALKAEGLN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctacaaaccgggcgcgtgctctcttgcttcccacattaccctgcgcgag
agcggcaaagatttcacgctggatggcgttgacctgatgaaaaaacgcctggaaaacggc
gatgatttttttgctattaacccgaagggacaagttccggctctgctgctggatgacggt
accctgctgaccgaaggcgtggcgattatgcaattcctcgccgatagcgtgcccgacagg
caattgctggcaccggtaagtacggtttctcgctacaaaacgctggagtggatgaactac
attgcgaccgagctgcacaaaggctttaccccgctgttccgtccggagacgccggaagag
tacaaaccgaccgtacgtgctcaactggagaaaaaactgcagtacgttaacgcatcgctg
aaagacgatcagtggattgggggcgcgcgttttacgattgccgatgcctatctgttcacc
gtgctgcgctgggcgcgggccattaagctcaacatggacgggctggaccacattgcatcg
tacatggatcgcgtagccgcgcgtcctgcggtggctgcagcgcttaaagcagaagggttg
aactga

DBGET integrated database retrieval system