KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_4178Help
Entry
ETEC_4178         CDS       T02069                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Brite
Enzymes [BR:elh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ETEC_4178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4523316..4523936
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKA
AASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQN
RRPDYIKEFWNVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagctataccctgccatccctgccgtatgcttacgatgccctggaaccgcacttcgat
aagcagaccatggaaatccaccacaccaaacaccatcagacctacgtaaacaacgccaac
gcggcgctggaaagcctgccagaatttgccaacctgccggttgaagagctgatcaccaaa
ctggaccagctgccagcagacaagaaaaccgtactgcgcaacaacgctggcggtcacgct
aaccacagcctgttctggaaaggtctgaaaaaaggcaccaccctgcagggtgacctgaaa
gcggctatcgaacgtgacttcggctccgttgataacttcaaagcagaatttgaaaaagcg
gcagcttcccgctttggttccggctgggcatggctggtgctgaaaggcgataaactggcg
gtggtttctactgctaaccaggattctccgctgatgggtgaagctatttctggcgcttcc
ggcttcccgattatgggcctggatgtgtgggaacatgcttactacctgaaattccagaac
cgccgtccggactacattaaagagttctggaacgtggtgaactgggacgaagcagcggca
cgttttgcggcgaaaaaataa

DBGET integrated database retrieval system