KEGG   Erythrobacter litoralis HTCC2594: ELI_01810Help
Entry
ELI_01810         CDS       T00315                                 

Definition
(GenBank) D-alanyl-D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ELI_01810
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ELI_01810
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ELI_01810
Enzymes [BR:eli01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ELI_01810
Peptidoglycan biosynthesis and degradation proteins [BR:eli01011]
 Precursor biosynthesis
  Amino acid ligase
   ELI_01810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
406600..407571
Genome map
AA seq 323 aa AA seqDB search
MSLDRKLHVVVLMGGWANEREVSLMSGEGVAKALEKRGHTVTRIDMDRQVAAKIAEAAPD
VVFNALHGVPGEDGTVQGMLDLMGVPYTHSGLATSVIAIDKELTKQQLVPRGIPMPGGRI
VQSEDLYQQDPLARPYVLKPVNEGSSVGVAIVTDESNYGNPIRRDAPGPWQEFRELLAEP
FIRGRELTTAVVGGQALAVTELKPKSGFYDFDAKYTDGMTEHVCPADIPPEIEALCKKYA
LEAHRILGCRGTSRTDYRWDDEQGDDGLFVLETNTQPGMTPLSLVPEQAAYAGMSYEDLV
EAIVEAALEHFAAKTGGNDGDQG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctcgaccgtaaactccacgtcgtcgtcctgatgggcggctgggcgaacgagcgc
gaagtctcgctgatgagcggcgagggtgtcgccaaggcgctcgagaagcgcggacacaca
gtgacgcggatcgacatggaccggcaggttgctgcgaagatcgccgaagctgcgcccgat
gtcgtcttcaacgcgctgcacggcgttcccggcgaggacggcaccgtgcaggggatgctc
gaccttatgggtgtgccctatacccattcggggctcgccacgtccgtgatcgcgatcgac
aaggaattgaccaagcagcagctcgtgccgcgcggcatccccatgcccggcgggcggatt
gtacagtcggaagacctctaccagcaggacccgctggcacggccctatgtgctgaagccg
gtcaacgaaggttcctcggtcggcgtcgctatcgtcaccgacgagagcaattacggcaat
ccgatccgtcgcgatgccccggggccgtggcaggaattccgtgagcttctcgccgagccc
ttcatccgcgggcgcgaactgaccacggcggtcgtcggcggacaggcgctggccgtgacc
gaactcaagcccaagagcggtttctacgatttcgatgccaaatataccgacgggatgacc
gagcatgtctgcccggccgatatcccgcccgagatcgaggcgctgtgcaagaaatacgcc
ctcgaggcgcatcgcatcctcggctgtcgcggcaccagtcgcaccgattatcgctgggac
gacgagcagggcgacgacggactgttcgtgcttgaaaccaacacgcagcccggcatgacc
ccgctcagcctagtacccgagcaggccgcctatgccggcatgagttacgaggacctcgtc
gaagcgatcgtggaggctgcgctcgaacatttcgccgcaaagaccggagggaacgatggc
gaccagggttaa

DBGET integrated database retrieval system