KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_07375Help
Entry
NRG857_07375      CDS       T02068                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:eln00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    NRG857_07375
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NRG857_07375
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NRG857_07375
   00430 Taurine and hypotaurine metabolism
    NRG857_07375
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    NRG857_07375
Enzymes [BR:eln01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     NRG857_07375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(1537501..1538901)
Genome map
AA seq 466 aa AA seqDB search
MDKKQVTDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNL
ATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVG
TNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTNKPNLVCGPVQICWHKFARYWDVELREI
PMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDM
HIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELV
FNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKL
GPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV
MRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggataagaagcaagtaacggatttaaggtcggaactactcgattcacgttttggtgcg
aagtctatttccactatcgcagaatcaaaacgttttccgctgcacgaaatgcgcgatgat
gttgcatttcagattatcaatgatgaattatatcttgatggcaacgctcgtcagaacctg
gccactttctgccagacctgggacgacgaaaacgtccataaattgatggatttgtcgatc
aataaaaactggatcgacaaagaagaatatccgcaatccgctgcaatcgacctgcgttgc
gtaaacatggttgccgatctgtggcatgcgcctgcaccgaaaaatggtcaggccgttggc
accaacaccattggttcttccgaggcctgtatgctcggcgggatggcgatgaaatggcgt
tggcgcaagcgtatggaagctgcaggtaagccgactaacaaaccgaacctggtgtgcggt
ccggtacaaatctgctggcataaattcgcccgctactgggatgtggagttgcgtgagatc
cctatgcgccccggtcagttgtttatggacccgaaacgcatgattgaagcctgcgacgaa
aataccatcggcgtggtgccgactttcggcgtgacctataccggtaactatgagttcccg
caaccgctgcacgatgcgctggataaattccaggccgacaccggtatcgacatcgacatg
cacatcgacgccgccagcggtggcttcctggcaccgttcgtcgccccggatatcgtctgg
gacttccgcctgccgcgtgtgaaatcgatcagtgcttcaggccataaattcggtctggct
ccgctgggctgcggctgggttatctggcgtgatgaagaagcgctgccgcaggaactggtg
ttcaacgttgactacctcggcggtcagattggtactttcgccatcaacttctcccgcccg
gcgggtcaggtgattgcacagtactatgaattcctgcgcctcggtcgtgaaggctataca
aaagtacagaacgcttcctaccaggttgctgcttatctggcggatgaaatcgccaaactg
gggccgtatgagttcatctgtacgggtcgcccggacgaaggcatcccggcggtttgcttc
aaactgaaagatggtgaagatccgggatacaccctgtatgacctctctgaacgtctgcgt
ctgcgcggctggcaggttccggccttcactctcggcggtgaagccactgacatcgtggtg
atgcgcattatgtgtcgtcgcggcttcgaaatggactttgctgaactgttgctggaagac
tacaaagcctccctgaaatatctcagcgaccacccgaaactgcagggtattgcccagcag
aacagctttaaacacacctga

DBGET integrated database retrieval system