KEGG   Esox lucius (northern pike): 105007706Help
Entry
105007706         CDS       T04894                                 

Gene name
tufm
Definition
(RefSeq) elongation factor Tu, mitochondrial isoform X2
  KO
K02358  elongation factor Tu
Organism
els  Esox lucius (northern pike)
Brite
Translation factors [BR:els03012]
 Eukaryotic Type
  Elongation factors
   105007706 (tufm)
 Prokaryotic Type
   105007706 (tufm)
Mitochondrial biogenesis [BR:els03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    105007706 (tufm)
Exosome [BR:els04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105007706 (tufm)
  Exosomal proteins of breast cancer cells
   105007706 (tufm)
  Exosomal proteins of colorectal cancer cells
   105007706 (tufm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 105007706
NCBI-ProteinID: XP_010865019
LinkDB All DBs
AA seq 461 aa AA seqDB search
MTSLPSSCLTLYKMAALVGIRACFSALQLSSPGLLHTSYKVCAVPFTRRNFAAEAKVKKT
YARDKPHVNIGTIGHVDHGKTTLTAAITKVLAEAGGANYKKYEDIDNAPEEKARGITINA
SHVEYATANRHYAHTDCPGHADYVKNMITGTAQLDGCILVVAATDGQMPQTREHLLLARQ
IGVENVVVFVNKADAVEDKEMLELVELEIRELLTEFGYDGENTPVVIGSALCALENRQPE
LGANAVLKLLQVVDEYVPLPKRELDKPFLLPIEGVYSIPGRGTVVTGTLERGVIKKGDDC
EFVGHSRAFKSVVTGIEMFHQSLDRAEAGDNLGALVRGLKREDIRRGMVMSKPGSIQPHQ
KVQAQVYILSKEEGGRHKPFVSNFMPVMFSLTWDMACMVTLPQDKEMVMPGEDTSLTLTL
RQPMVLEKGQRFTLRDGNKTIGTGLVTEILTATEDDGCNWG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcacttccatctagttgtctaacattgtacaagatggcggcgctcgtagggatt
cgtgcatgtttctctgctcttcagctttcctcgccgggtcttctgcacacctcctataaa
gtgtgtgcagtgccatttactcggcggaactttgcagcagaggccaaggttaagaaaaca
tacgcgagagacaaaccccatgttaacatcggcacgattggacatgtcgaccatggcaag
accactctcacagctgccatcaccaaagtgctggcggaggctggaggcgccaactataag
aagtatgaggacattgacaatgctcctgaagagaaggccaggggtatcaccatcaatgcg
tcccatgtagagtatgccacagccaacagacactacgcgcacacagactgtcctggccat
gctgactatgtcaagaacatgatcacgggcacggctcagcttgatggctgcatcctggtg
gtggccgccacggacggccagatgccccagaccagggagcacctcctgctggcgcggcag
atcggcgtggagaacgttgtggtgtttgtgaacaaggcggatgctgtggaggacaaggag
atgctggagctcgtggagctggagatccgtgagctgctcaccgagttcggctacgatggc
gagaacacgcccgtggtcatcggctcggctctctgcgccctggagaacagacagccagag
ctgggagcaaacgctgtgttgaagcttctgcaggttgtggatgaatatgttccgctgccc
aaaagagaactcgataaacccttcctgctgcctatcgagggtgtctattccatcccaggc
aggggtacagtggtgactggcactttggagaggggtgtcatcaagaagggtgacgattgt
gagtttgtgggtcacagccgcgctttcaagtcggtggtcactggcatcgagatgttccat
cagtctctggaccgggccgaggccggggataacctgggggctctggtccgagggctgaag
agggaggacatcaggcgagggatggtgatgagcaaaccaggctccattcagccccaccag
aaagtccaggcccaggtttatattctgagtaaggaggagggaggaagacacaagcccttt
gtcagcaacttcatgcctgtcatgttctctctcacctgggacatggcctgcatggtcacc
ctgccccaagacaaggaaatggtgatgccaggtgaggatacttctctgaccctgacgctg
cgccagcctatggttctggagaaaggtcaacgctttactctccgagacggaaacaaaact
attggcaccggcctggttactgaaatacttaccgcaacagaagacgacggttgcaattgg
ggctga

DBGET integrated database retrieval system