KEGG   Esox lucius (northern pike): 105007882Help
Entry
105007882         CDS       T04894                                 

Gene name
neu4
Definition
(RefSeq) sialidase-4
  KO
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
els  Esox lucius (northern pike)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:els00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    105007882 (neu4)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    105007882 (neu4)
Enzymes [BR:els01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     105007882 (neu4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
AA seq 475 aa AA seqDB search
MRSSPYFPARSVLFRKEANGVTYRVPALLYLSRSNSFLAFCEERLSPSDAQAHLLVVRKG
TFYRNYVEWEDMRVLGTARLVGHRSMNPCPLYDEFTGTLFLFFIAVLGHTSESYQLITGK
NVTRLCFISSTDQGNTWSPAIDLTKKVIGDTIKDWATFALGPGHGIQLKSGRLLVPAYAY
HIDCRECFGQMCQTTPHAFCFHSDTHGRTWRFGEAVPGPESVECQMVSVDEEDGTNVLYC
NARSPLGCRVQSLSLDDGAVFQDGQLVQRLTEPRNGCHGSVVGFPAPLHLNLHHEPTSHS
RHWTSFTAKSLDSSGATTPHPCSTQNFLTPTWVVYSHPTWANARKDLGVYLSLFPRDPDS
WSGPWVIYEGPSAYSDLAYLELPSAGAPSAVAFACLFECGTSTAYDEISFSIFTLYELID
NLPRNTNSARKTQACTDNQAASKTHRFHNTTRVMEKRPEVRKRRIRNLCCLCNVS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagatcgtcgccgtatttccctgcacgctctgtgttgttccgtaaggaggccaatgga
gtgacgtaccgtgtcccagctctcctctacttgtctcgctccaactccttcctggccttc
tgcgaggaaagactcagcccctcagatgcccaggctcacctgctggtcgtgcgcaaaggc
accttctacagaaactatgtggagtgggaagacatgcgtgttttgggcacagctcggttg
gtgggccaccgatcgatgaacccatgcccgctgtacgatgagttcacaggcactctcttc
ctattcttcatcgctgtgctaggccatacctctgagtcataccagctgatcacggggaag
aacgtcacgcgcctctgcttcatctccagtactgatcagggaaacacctggagccccgcc
attgacctgaccaagaaggttataggagacaccatcaaagactgggccaccttcgccttg
ggcccaggacacggcatccagctgaagtcaggccgtttactggtcccagcttatgcctat
cacatcgactgcagggagtgctttggccagatgtgccagaccacgccgcacgccttctgt
ttccatagtgacacccatggccggacgtggcggttcggggaggcggttcccgggccggag
agtgtggagtgccagatggtctctgttgatgaggaggatgggacaaacgtgttgtactgt
aacgcacggagcccccttggctgcagggtgcagtcgctgagtctggacgatggggctgtc
ttccaggatggacagttggtgcagcgactcacggagcctcgcaatggctgccacggcagt
gtagtggggttccctgccccccttcacctcaacctccaccatgagccaacaagccactcc
agacactggacttccttcacagctaagtcccttgactcatccggagccaccacccctcat
ccttgctccacgcagaattttcttacccctacctgggtggtgtactcacacccgacgtgg
gccaacgcgagaaaggacctgggcgtgtacctcagcctgttcccccgtgacccagatagc
tggtctggcccatgggtcatctacgaaggtcctagtgcctactctgacctggcttacctg
gagctgccatcagcaggagccccgtctgccgtggccttcgcctgcctgtttgagtgtggc
accagcacagcctacgatgagatttccttcagcatcttcacactgtatgaacttattgac
aacctgccccgcaacacaaattcagctaggaaaacacaggcatgtactgacaatcaggca
gctagcaaaacacataggtttcacaatacaacaagagtgatggaaaagaggccagaggta
aggaagaggaggataaggaatctgtgttgtctttgcaatgtttcataa

DBGET integrated database retrieval system